BLASTX nr result
ID: Angelica23_contig00020510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020510 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313510.1| aquaporin, MIP family, PIP subfamily [Populu... 62 4e-08 gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia] 59 4e-07 dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus com... 59 4e-07 gb|AAW80918.1| putative plasma membrane intrinsic protein [Astra... 59 5e-07 dbj|BAE48656.1| aquaporin [Prunus mume] 59 5e-07 >ref|XP_002313510.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] gi|222849918|gb|EEE87465.1| aquaporin, MIP family, PIP subfamily [Populus trichocarpa] Length = 284 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +3 Query: 108 MGKDIEVAEHG---RDYQDPPPVDFFDAQELGSWSFYRAI 218 M KDIEVAEHG +DYQDPPP DA+ELG WSFYRA+ Sbjct: 1 MAKDIEVAEHGETVKDYQDPPPAPLIDAEELGQWSFYRAL 40 >gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia] Length = 281 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = +3 Query: 108 MGKDIEVAEHG----RDYQDPPPVDFFDAQELGSWSFYRAI 218 M KDIE AEHG +DYQDPPP FDA+EL WSFYRA+ Sbjct: 1 MAKDIEGAEHGEFASKDYQDPPPTPLFDAEELTKWSFYRAV 41 >dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis] Length = 281 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = +3 Query: 108 MGKDIEVAEHG----RDYQDPPPVDFFDAQELGSWSFYRAI 218 M KD+EVAEHG +DY DPPP FDA+EL WSFYRA+ Sbjct: 1 MAKDVEVAEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRAL 41 >gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus] Length = 283 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = +3 Query: 108 MGKDIEVAEHG----RDYQDPPPVDFFDAQELGSWSFYRAI 218 MGKD+EVAEHG +DY DPPP D EL SWSFYRAI Sbjct: 1 MGKDVEVAEHGEFSAKDYTDPPPAPLIDMAELASWSFYRAI 41 >dbj|BAE48656.1| aquaporin [Prunus mume] Length = 281 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = +3 Query: 108 MGKDIEVAEHG----RDYQDPPPVDFFDAQELGSWSFYRAI 218 M KD+E AEHG +DY DPPP FFDA+EL WSFYRA+ Sbjct: 1 MAKDVEGAEHGEFAAKDYHDPPPTPFFDAEELTKWSFYRAL 41