BLASTX nr result
ID: Angelica23_contig00020351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00020351 (472 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629886.1| Elongation factor 1-alpha [Medicago truncatu... 71 8e-11 ref|XP_003629885.1| Elongation factor 1-alpha [Medicago truncatu... 71 8e-11 ref|XP_003532775.1| PREDICTED: HBS1-like protein-like [Glycine max] 64 2e-08 ref|XP_003524985.1| PREDICTED: HBS1-like protein-like [Glycine max] 60 1e-07 emb|CBI34018.3| unnamed protein product [Vitis vinifera] 60 2e-07 >ref|XP_003629886.1| Elongation factor 1-alpha [Medicago truncatula] gi|355523908|gb|AET04362.1| Elongation factor 1-alpha [Medicago truncatula] Length = 746 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/53 (64%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +1 Query: 313 GVESRTKHVTIDSAVWSCPICTYDNEDDMPCCDICGVFRNPLVKSG-SNSNVT 468 GVES TK TI VWSC ICTYDN++ M CDICGV R+PLV +G SN+N T Sbjct: 32 GVESDTKKETIKPGVWSCSICTYDNDESMTSCDICGVLRHPLVINGTSNTNKT 84 >ref|XP_003629885.1| Elongation factor 1-alpha [Medicago truncatula] gi|355523907|gb|AET04361.1| Elongation factor 1-alpha [Medicago truncatula] Length = 704 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/53 (64%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +1 Query: 313 GVESRTKHVTIDSAVWSCPICTYDNEDDMPCCDICGVFRNPLVKSG-SNSNVT 468 GVES TK TI VWSC ICTYDN++ M CDICGV R+PLV +G SN+N T Sbjct: 32 GVESDTKKETIKPGVWSCSICTYDNDESMTSCDICGVLRHPLVINGTSNTNKT 84 >ref|XP_003532775.1| PREDICTED: HBS1-like protein-like [Glycine max] Length = 714 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/48 (60%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +1 Query: 328 TKHVTIDSAVWSCPICTYDNEDDMPCCDICGVFRNPLVKSG-SNSNVT 468 TK TI +W C ICTYDN++ M CDICGV R PLV +G SNSN T Sbjct: 38 TKQETIKPGLWQCSICTYDNDESMTFCDICGVVRRPLVNTGTSNSNKT 85 >ref|XP_003524985.1| PREDICTED: HBS1-like protein-like [Glycine max] Length = 793 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/48 (58%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +1 Query: 328 TKHVTIDSAVWSCPICTYDNEDDMPCCDICGVFRNPLVKSG-SNSNVT 468 TK TI +W C ICTYDN++ M CDICGV R LV +G SNSN T Sbjct: 39 TKQETIKPGLWQCSICTYDNDESMTFCDICGVVRRSLVNTGTSNSNKT 86 >emb|CBI34018.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/54 (44%), Positives = 33/54 (61%) Frame = +1 Query: 301 VQEKGVESRTKHVTIDSAVWSCPICTYDNEDDMPCCDICGVFRNPLVKSGSNSN 462 V+E G T T+ +W C ICT+DN++ M CDICGV R PLV +N++ Sbjct: 30 VEENGEAVETNQETVRRGIWRCSICTFDNDESMSACDICGVLRYPLVNIRNNND 83