BLASTX nr result
ID: Angelica23_contig00019961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00019961 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF20002.1|AF213936_1 amino acid/peptide transporter [Prunus ... 58 7e-07 ref|XP_002315835.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|NP_001233998.1| oligopeptide transporter 1 [Solanum lycopers... 57 2e-06 ref|XP_002521890.1| peptide transporter, putative [Ricinus commu... 56 3e-06 ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vi... 55 4e-06 >gb|AAF20002.1|AF213936_1 amino acid/peptide transporter [Prunus dulcis] Length = 559 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -1 Query: 167 KNLTRRIPIWAIKVVFSTVYAQMLIMFIEPGLMMDTYIGFSDTPTAFLLSLGSIS 3 K L R PIWA +VFS VYAQM MF+E G+MMDT +G P A L S IS Sbjct: 345 KILIRMFPIWATGIVFSAVYAQMATMFVEQGMMMDTSVGSFTIPPASLSSFDVIS 399 >ref|XP_002315835.1| predicted protein [Populus trichocarpa] gi|222864875|gb|EEF02006.1| predicted protein [Populus trichocarpa] Length = 584 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -1 Query: 167 KNLTRRIPIWAIKVVFSTVYAQMLIMFIEPGLMMDTYIGFSDTPTAFLLSLGSIS 3 K L R PIWA +VFS VYAQM MF+E G++MDT IG P A L S IS Sbjct: 346 KILIRMFPIWATGIVFSAVYAQMSTMFVEQGMLMDTTIGSFTIPPASLSSFDVIS 400 >ref|NP_001233998.1| oligopeptide transporter 1 [Solanum lycopersicum] gi|4102839|gb|AAD01600.1| LeOPT1 [Solanum lycopersicum] Length = 580 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -1 Query: 167 KNLTRRIPIWAIKVVFSTVYAQMLIMFIEPGLMMDTYIGFSDTPTAFLLSLGSIS 3 K L R PIWA +VFS VYAQM MF+E G++MDT +G P A L + +IS Sbjct: 341 KILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVMDTAVGSFKIPAASLSTFDTIS 395 >ref|XP_002521890.1| peptide transporter, putative [Ricinus communis] gi|223538928|gb|EEF40526.1| peptide transporter, putative [Ricinus communis] Length = 585 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/55 (52%), Positives = 34/55 (61%) Frame = -1 Query: 167 KNLTRRIPIWAIKVVFSTVYAQMLIMFIEPGLMMDTYIGFSDTPTAFLLSLGSIS 3 K L R PIWA +VFS VYAQM MF+E G++MDT IG P A L + IS Sbjct: 346 KILVRMFPIWATGIVFSAVYAQMSTMFVEQGMLMDTTIGSFTIPPASLSTFDVIS 400 >ref|XP_002285274.1| PREDICTED: peptide transporter PTR2-like [Vitis vinifera] Length = 586 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/55 (52%), Positives = 34/55 (61%) Frame = -1 Query: 167 KNLTRRIPIWAIKVVFSTVYAQMLIMFIEPGLMMDTYIGFSDTPTAFLLSLGSIS 3 K L R PIWA +VFS VYAQM MF+E G++MDT IG P A L + IS Sbjct: 347 KILIRMFPIWATGIVFSAVYAQMSTMFVEQGMVMDTNIGSFTIPPASLSTFDVIS 401