BLASTX nr result
ID: Angelica23_contig00019764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00019764 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD96953.1| hypothetical protein [Cleome spinosa] 68 9e-10 emb|CAG28949.1| S-adenosylmethionine decarboxylase [Prunus persica] 66 3e-09 gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prun... 66 3e-09 gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] 65 6e-09 ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylas... 65 6e-09 >gb|ABD96953.1| hypothetical protein [Cleome spinosa] Length = 78 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 281 TLFYEAPLGYSIEDIRPHGGIKKFKSAAYSNFAR 382 TLFYEAPLGYSIED+RPHGGIKKF+SAAYSN A+ Sbjct: 42 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCAK 75 >emb|CAG28949.1| S-adenosylmethionine decarboxylase [Prunus persica] Length = 309 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 281 TLFYEAPLGYSIEDIRPHGGIKKFKSAAYSNFAR 382 +LFYEAPLGYSIED+RPHGGIKKF+SAAYSN R Sbjct: 15 SLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVR 48 >gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prunus dulcis] Length = 56 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 281 TLFYEAPLGYSIEDIRPHGGIKKFKSAAYSNFAR 382 +LFYEAPLGYSIED+RPHGGIKKF+SAAYSN R Sbjct: 20 SLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVR 53 >gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] Length = 53 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 281 TLFYEAPLGYSIEDIRPHGGIKKFKSAAYSNFAR 382 +LFYEAPLGYSIEDIRP+GGIKKF+SAAYSN AR Sbjct: 17 SLFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCAR 50 >ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Vitis vinifera] Length = 410 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 281 TLFYEAPLGYSIEDIRPHGGIKKFKSAAYSNFAR 382 +LFYEAPLGYSIEDIRP+GGIKKF+SAAYSN AR Sbjct: 14 SLFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCAR 47