BLASTX nr result
ID: Angelica23_contig00019606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00019606 (764 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002320827.1| predicted protein [Populus trichocarpa] gi|2... 65 2e-08 ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_002511921.1| pentatricopeptide repeat-containing protein,... 63 8e-08 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 67.4 bits (163), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 762 MDQMTQQACNPDYITMEILTDWLSTVGETEKLQKFVEG 649 MD+MT+ ACNPDYITMEILT+WLS VGET KL+ FV+G Sbjct: 720 MDRMTEHACNPDYITMEILTEWLSAVGETAKLKSFVQG 757 >ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] gi|449475521|ref|XP_004154479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] Length = 660 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 762 MDQMTQQACNPDYITMEILTDWLSTVGETEKLQKFVEG 649 MD+M +QACNPDYITMEILT+WLS VGE KL+KF +G Sbjct: 569 MDRMVEQACNPDYITMEILTEWLSAVGEITKLKKFTQG 606 >ref|XP_002320827.1| predicted protein [Populus trichocarpa] gi|222861600|gb|EEE99142.1| predicted protein [Populus trichocarpa] Length = 775 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 762 MDQMTQQACNPDYITMEILTDWLSTVGETEKLQKFVEG 649 MD+M + ACNPDYITMEILT+WLS VGE E+L+KFV G Sbjct: 723 MDRMIEHACNPDYITMEILTEWLSAVGEIERLKKFVAG 760 >ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Glycine max] Length = 746 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 762 MDQMTQQACNPDYITMEILTDWLSTVGETEKLQKFVEG 649 MD+M ++AC PDYITME+LT+WLS VGE EKL+ FVEG Sbjct: 697 MDRMVEEACRPDYITMEVLTEWLSAVGEIEKLKHFVEG 734 >ref|XP_002511921.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549101|gb|EEF50590.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 248 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 762 MDQMTQQACNPDYITMEILTDWLSTVGETEKLQKFVEGI 646 MD+M +Q CNPDYITMEILT+WLS VGETEKL+K I Sbjct: 210 MDRMMEQPCNPDYITMEILTEWLSAVGETEKLKKLCSRI 248