BLASTX nr result
ID: Angelica23_contig00019281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00019281 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ15553.1| 1,3-beta-glucan synthase [Malus x domestica] 57 2e-06 ref|XP_002263757.2| PREDICTED: callose synthase 11-like [Vitis v... 56 3e-06 ref|XP_003607458.1| Callose synthase [Medicago truncatula] gi|35... 56 3e-06 gb|ADE75717.1| unknown [Picea sitchensis] 55 5e-06 emb|CAZ15554.1| 1,3-beta-glucan synthase [Malus x domestica] 55 5e-06 >emb|CAZ15553.1| 1,3-beta-glucan synthase [Malus x domestica] Length = 132 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 359 VIFMTPI-VLSWLSGFQSMQTRIFLNEAFDRGLQINKILT 243 VI M P+ +LSWL GFQSMQTRI NEAF RGLQI++IL+ Sbjct: 88 VIVMAPVALLSWLPGFQSMQTRILFNEAFSRGLQISRILS 127 >ref|XP_002263757.2| PREDICTED: callose synthase 11-like [Vitis vinifera] Length = 1670 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 359 VIFMTPI-VLSWLSGFQSMQTRIFLNEAFDRGLQINKILT 243 +I + P+ +LSW+ GFQSMQTRI NEAF RGLQI++ILT Sbjct: 1624 IIILAPVALLSWMPGFQSMQTRILFNEAFSRGLQISRILT 1663 >ref|XP_003607458.1| Callose synthase [Medicago truncatula] gi|355508513|gb|AES89655.1| Callose synthase [Medicago truncatula] Length = 1815 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -2 Query: 359 VIFMTPI-VLSWLSGFQSMQTRIFLNEAFDRGLQINKILT 243 VI MTP+ +LSWL GFQ+MQTRI NEAF RGL+I++I+T Sbjct: 1718 VIIMTPVALLSWLPGFQNMQTRILFNEAFSRGLRISQIVT 1757 >gb|ADE75717.1| unknown [Picea sitchensis] Length = 248 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 359 VIFMTPI-VLSWLSGFQSMQTRIFLNEAFDRGLQINKIL 246 +I M P+ +LSWL GFQSMQTRI NEAF RGLQI++IL Sbjct: 201 IIVMIPMAILSWLPGFQSMQTRILFNEAFSRGLQISRIL 239 >emb|CAZ15554.1| 1,3-beta-glucan synthase [Malus x domestica] Length = 228 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 359 VIFMTPI-VLSWLSGFQSMQTRIFLNEAFDRGLQINKILT 243 VI MTP+ VLSW GFQSMQTRI NEAF+RGL+I +I+T Sbjct: 180 VIVMTPVAVLSWFPGFQSMQTRILFNEAFNRGLRIFQIVT 219