BLASTX nr result
ID: Angelica23_contig00019107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00019107 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD48972.1|AF162444_4 contains similarity to S. cerevisiae va... 60 1e-07 ref|NP_567281.2| vacuolar protein sorting-associated protein 28-... 60 1e-07 dbj|BAJ33668.1| unnamed protein product [Thellungiella halophila] 59 3e-07 ref|XP_002872726.1| hypothetical protein ARALYDRAFT_490145 [Arab... 59 3e-07 gb|ADB85104.1| vacuolar protein sorting-associated protein VPS28... 59 3e-07 >gb|AAD48972.1|AF162444_4 contains similarity to S. cerevisiae vacuolar protein sorting-associated protein VPS28 (GB:U39205) [Arabidopsis thaliana] gi|7267259|emb|CAB81042.1| AT4g05000 [Arabidopsis thaliana] Length = 209 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 126 MDVKLWNDKQEREMYENFSELFAIIKATEK 215 M+VKLWNDK+EREMYENF+ELFAIIKATEK Sbjct: 1 MEVKLWNDKREREMYENFAELFAIIKATEK 30 >ref|NP_567281.2| vacuolar protein sorting-associated protein 28-2 [Arabidopsis thaliana] gi|42572833|ref|NP_974513.1| vacuolar protein sorting-associated protein 28-2 [Arabidopsis thaliana] gi|152061129|sp|Q9S9T7.2|VP282_ARATH RecName: Full=Vacuolar protein sorting-associated protein 28 homolog 2 gi|50253482|gb|AAT71943.1| At4g05000 [Arabidopsis thaliana] gi|52421311|gb|AAU45225.1| At4g05000 [Arabidopsis thaliana] gi|110738465|dbj|BAF01158.1| hypothetical protein [Arabidopsis thaliana] gi|332657056|gb|AEE82456.1| vacuolar protein sorting-associated protein 28-2 [Arabidopsis thaliana] gi|332657057|gb|AEE82457.1| vacuolar protein sorting-associated protein 28-2 [Arabidopsis thaliana] Length = 210 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 126 MDVKLWNDKQEREMYENFSELFAIIKATEK 215 M+VKLWNDK+EREMYENF+ELFAIIKATEK Sbjct: 2 MEVKLWNDKREREMYENFAELFAIIKATEK 31 >dbj|BAJ33668.1| unnamed protein product [Thellungiella halophila] Length = 209 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 126 MDVKLWNDKQEREMYENFSELFAIIKATEK 215 M+VKLWNDK+EREMYENF+EL+AIIKATEK Sbjct: 1 MEVKLWNDKREREMYENFAELYAIIKATEK 30 >ref|XP_002872726.1| hypothetical protein ARALYDRAFT_490145 [Arabidopsis lyrata subsp. lyrata] gi|297318563|gb|EFH48985.1| hypothetical protein ARALYDRAFT_490145 [Arabidopsis lyrata subsp. lyrata] Length = 209 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 126 MDVKLWNDKQEREMYENFSELFAIIKATEK 215 M+VKLWNDK+ER+MYENF+ELFAIIKATEK Sbjct: 1 MEVKLWNDKRERDMYENFAELFAIIKATEK 30 >gb|ADB85104.1| vacuolar protein sorting-associated protein VPS28 [Jatropha curcas] Length = 209 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 126 MDVKLWNDKQEREMYENFSELFAIIKATEK 215 M+VKLWNDK+EREMYENF+EL+AIIKATEK Sbjct: 1 MEVKLWNDKREREMYENFAELYAIIKATEK 30