BLASTX nr result
ID: Angelica23_contig00018335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00018335 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACD39377.1| NAC domain protein [Glycine max] 100 2e-19 ref|XP_002520341.1| NAC domain-containing protein, putative [Ric... 99 5e-19 gb|ACS94038.1| NAC family transcription factor 5 [Cicer arietinum] 98 8e-19 dbj|BAJ34268.1| unnamed protein product [Thellungiella halophila] 97 1e-18 ref|XP_003602038.1| NAC domain protein [Medicago truncatula] gi|... 97 1e-18 >gb|ACD39377.1| NAC domain protein [Glycine max] Length = 162 Score = 99.8 bits (247), Expect = 2e-19 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +2 Query: 68 MAGAVDLQLPPGFRFHPTDDELVMHYLCRKCACQQIDVAIIKELDLYKHDPWDLPG 235 MA A L LPPGFRFHPTD+ELV+HYLCRKCA Q+I V II E+DLYK+DPWDLPG Sbjct: 1 MAAATQLHLPPGFRFHPTDEELVVHYLCRKCASQEIAVPIIAEIDLYKYDPWDLPG 56 >ref|XP_002520341.1| NAC domain-containing protein, putative [Ricinus communis] gi|223540560|gb|EEF42127.1| NAC domain-containing protein, putative [Ricinus communis] Length = 369 Score = 98.6 bits (244), Expect = 5e-19 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = +2 Query: 77 AVDLQLPPGFRFHPTDDELVMHYLCRKCACQQIDVAIIKELDLYKHDPWDLPG 235 A L+LPPGFRFHPTD+ELVMHYLCRKCA QQI V II E+DLYK+DPWDLPG Sbjct: 80 AAVLELPPGFRFHPTDEELVMHYLCRKCASQQIAVPIIAEIDLYKYDPWDLPG 132 >gb|ACS94038.1| NAC family transcription factor 5 [Cicer arietinum] Length = 291 Score = 97.8 bits (242), Expect = 8e-19 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +2 Query: 77 AVDLQLPPGFRFHPTDDELVMHYLCRKCACQQIDVAIIKELDLYKHDPWDLPG 235 A +LQLPPGFRFHPTD+ELVMHYLCRKC Q I V II E+DLYK+DPWDLPG Sbjct: 2 ASELQLPPGFRFHPTDEELVMHYLCRKCTSQPISVPIIAEIDLYKYDPWDLPG 54 >dbj|BAJ34268.1| unnamed protein product [Thellungiella halophila] Length = 290 Score = 97.4 bits (241), Expect = 1e-18 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 83 DLQLPPGFRFHPTDDELVMHYLCRKCACQQIDVAIIKELDLYKHDPWDLPG 235 +LQLPPGFRFHPTD+ELVMHYLCRKCA Q I V II E+DLYK+DPW+LPG Sbjct: 3 ELQLPPGFRFHPTDEELVMHYLCRKCASQSISVPIIAEIDLYKYDPWELPG 53 >ref|XP_003602038.1| NAC domain protein [Medicago truncatula] gi|355491086|gb|AES72289.1| NAC domain protein [Medicago truncatula] Length = 288 Score = 97.1 bits (240), Expect = 1e-18 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = +2 Query: 77 AVDLQLPPGFRFHPTDDELVMHYLCRKCACQQIDVAIIKELDLYKHDPWDLPG 235 A +LQLPPGFRFHPTD+ELVMHYLCRKC Q I V II E+DLYK+DPWDLPG Sbjct: 2 ASELQLPPGFRFHPTDEELVMHYLCRKCTSQPIAVPIIAEIDLYKYDPWDLPG 54