BLASTX nr result
ID: Angelica23_contig00018215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00018215 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527654.1| RNA binding protein, putative [Ricinus commu... 83 3e-14 ref|XP_002271867.1| PREDICTED: uncharacterized protein LOC100263... 81 1e-13 emb|CAN65474.1| hypothetical protein VITISV_018244 [Vitis vinifera] 81 1e-13 ref|XP_002511212.1| conserved hypothetical protein [Ricinus comm... 80 2e-13 ref|XP_002526725.1| conserved hypothetical protein [Ricinus comm... 80 2e-13 >ref|XP_002527654.1| RNA binding protein, putative [Ricinus communis] gi|223532959|gb|EEF34725.1| RNA binding protein, putative [Ricinus communis] Length = 830 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/79 (48%), Positives = 53/79 (67%) Frame = -2 Query: 238 TWESRCVLFRSFGLSNDEILSMFKKVPLIMCYKEKTINKKMEFFLNKLQWTLSRLLSNPA 59 TW+ + FR + LS DEILS F+K P M + E++I KM+F +N++ W + +L NPA Sbjct: 687 TWKCKIDAFRRWDLSEDEILSAFRKYPHCMSFSEESITNKMDFLVNRMGWQPAVILKNPA 746 Query: 58 VLVYSLENRIIPRCSVLQV 2 YSLE RI PRCSV++V Sbjct: 747 YFTYSLEKRIAPRCSVVRV 765 >ref|XP_002271867.1| PREDICTED: uncharacterized protein LOC100263451 [Vitis vinifera] Length = 412 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/79 (46%), Positives = 52/79 (65%) Frame = -2 Query: 238 TWESRCVLFRSFGLSNDEILSMFKKVPLIMCYKEKTINKKMEFFLNKLQWTLSRLLSNPA 59 TWE + ++R +GLSN EI+ +F+ P+ M EK I M+F +NK+ W L+ + P+ Sbjct: 269 TWEHKMEVYRRWGLSNHEIMLLFRAFPICMSLSEKKIMSTMDFLVNKMGWKLTAITKVPS 328 Query: 58 VLVYSLENRIIPRCSVLQV 2 L YSLE RIIPRCSV +V Sbjct: 329 TLSYSLEKRIIPRCSVARV 347 >emb|CAN65474.1| hypothetical protein VITISV_018244 [Vitis vinifera] Length = 455 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/79 (46%), Positives = 52/79 (65%) Frame = -2 Query: 238 TWESRCVLFRSFGLSNDEILSMFKKVPLIMCYKEKTINKKMEFFLNKLQWTLSRLLSNPA 59 TWE + ++R +GLSN EI+ +F+ P+ M EK I M+F +NK+ W L+ + P+ Sbjct: 269 TWEHKMEVYRRWGLSNHEIMLLFRAFPICMSLSEKKIMSTMDFLVNKMGWXLTAITKVPS 328 Query: 58 VLVYSLENRIIPRCSVLQV 2 L YSLE RIIPRCSV +V Sbjct: 329 TLSYSLEKRIIPRCSVARV 347 >ref|XP_002511212.1| conserved hypothetical protein [Ricinus communis] gi|223550327|gb|EEF51814.1| conserved hypothetical protein [Ricinus communis] Length = 423 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/78 (50%), Positives = 52/78 (66%) Frame = -2 Query: 235 WESRCVLFRSFGLSNDEILSMFKKVPLIMCYKEKTINKKMEFFLNKLQWTLSRLLSNPAV 56 W+ + +RSFGLSNDEI FK P+ M EK I K M+FF+NKL + S + NP + Sbjct: 288 WDRKLEAYRSFGLSNDEIHLAFKLQPMCMLSSEKKIRKLMDFFVNKLNISPSVISKNPNL 347 Query: 55 LVYSLENRIIPRCSVLQV 2 ++ SLE RI+PRCSVL + Sbjct: 348 MLLSLEKRILPRCSVLNI 365 >ref|XP_002526725.1| conserved hypothetical protein [Ricinus communis] gi|223533914|gb|EEF35639.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/79 (43%), Positives = 53/79 (67%) Frame = -2 Query: 238 TWESRCVLFRSFGLSNDEILSMFKKVPLIMCYKEKTINKKMEFFLNKLQWTLSRLLSNPA 59 TWE + +++ +G S +E L +F K P +M Y EK I K M++++NK+ W S + +P Sbjct: 308 TWEKKFDIYKKWGWSQEETLVVFGKFPWVMMYSEKKIMKMMDYYINKMGWDSSSIAKHPL 367 Query: 58 VLVYSLENRIIPRCSVLQV 2 ++ SLE R+IPRCSV+QV Sbjct: 368 LISLSLEKRVIPRCSVIQV 386