BLASTX nr result
ID: Angelica23_contig00017946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00017946 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281895.2| PREDICTED: uncharacterized protein LOC100267... 86 4e-15 emb|CBI16241.3| unnamed protein product [Vitis vinifera] 86 4e-15 emb|CAN64164.1| hypothetical protein VITISV_018167 [Vitis vinifera] 86 4e-15 ref|XP_003597140.1| CCR4-NOT transcription complex subunit [Medi... 84 1e-14 ref|XP_002864671.1| hypothetical protein ARALYDRAFT_358235 [Arab... 84 1e-14 >ref|XP_002281895.2| PREDICTED: uncharacterized protein LOC100267264 [Vitis vinifera] Length = 1024 Score = 85.5 bits (210), Expect = 4e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 260 QICVWCWHHIINMAKKDKVEGRCPACHTPYNKEKIVDKAAECER 129 +ICVWCWHHI+NMA+KD+ EGRCPAC PYNKEKIV AA+C+R Sbjct: 31 EICVWCWHHIMNMAEKDETEGRCPACRVPYNKEKIVGMAADCKR 74 >emb|CBI16241.3| unnamed protein product [Vitis vinifera] Length = 1022 Score = 85.5 bits (210), Expect = 4e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 260 QICVWCWHHIINMAKKDKVEGRCPACHTPYNKEKIVDKAAECER 129 +ICVWCWHHI+NMA+KD+ EGRCPAC PYNKEKIV AA+C+R Sbjct: 31 EICVWCWHHIMNMAEKDETEGRCPACRVPYNKEKIVGMAADCKR 74 >emb|CAN64164.1| hypothetical protein VITISV_018167 [Vitis vinifera] Length = 245 Score = 85.5 bits (210), Expect = 4e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 260 QICVWCWHHIINMAKKDKVEGRCPACHTPYNKEKIVDKAAECER 129 +ICVWCWHHI+NMA+KD+ EGRCPAC PYNKEKIV AA+C+R Sbjct: 31 EICVWCWHHIMNMAEKDETEGRCPACRVPYNKEKIVGMAADCKR 74 >ref|XP_003597140.1| CCR4-NOT transcription complex subunit [Medicago truncatula] gi|355486188|gb|AES67391.1| CCR4-NOT transcription complex subunit [Medicago truncatula] Length = 1007 Score = 84.0 bits (206), Expect = 1e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 260 QICVWCWHHIINMAKKDKVEGRCPACHTPYNKEKIVDKAAECER 129 QICVWCWHHI++MA+KD+ EGRCPAC +PY+KEKIV AA CER Sbjct: 31 QICVWCWHHIMDMAEKDETEGRCPACRSPYDKEKIVGMAANCER 74 >ref|XP_002864671.1| hypothetical protein ARALYDRAFT_358235 [Arabidopsis lyrata subsp. lyrata] gi|297310506|gb|EFH40930.1| hypothetical protein ARALYDRAFT_358235 [Arabidopsis lyrata subsp. lyrata] Length = 1001 Score = 84.0 bits (206), Expect = 1e-14 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = -3 Query: 260 QICVWCWHHIINMAKKDKVEGRCPACHTPYNKEKIVDKAAECERF*NMQSSGRHKIMSAE 81 QICVWCWHHI++MA+KD++EGRCPAC TPY+KEKIV +C+ + + R KI ++ Sbjct: 31 QICVWCWHHIVDMAEKDQIEGRCPACRTPYDKEKIVGMTVDCDSLASEGNMERKKIQKSK 90