BLASTX nr result
ID: Angelica23_contig00017863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00017863 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144217.1| PREDICTED: copper transporter 5-like [Cucumi... 55 8e-06 >ref|XP_004144217.1| PREDICTED: copper transporter 5-like [Cucumis sativus] gi|449489282|ref|XP_004158267.1| PREDICTED: copper transporter 5-like isoform 1 [Cucumis sativus] gi|449489286|ref|XP_004158268.1| PREDICTED: copper transporter 5-like isoform 2 [Cucumis sativus] Length = 142 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 11/93 (11%) Frame = -1 Query: 379 FYWAENVALLFDSWKTNPLISMAIILLFSSFFGVVFNYVTDFLIRFKILD---------- 230 FYW+ V LL +SW+T S ++ LL + + Y+ ++ IR K+L Sbjct: 6 FYWSREVTLLINSWRTTSWFSYSLSLLACFIVSIFYQYLENYRIRLKLLQCPKPSPSEIE 65 Query: 229 -PQLLSKLANGGKLSKFVGAVLFLVTSAVPFMI 134 P L SK+A + +F GA+ F V SA+ +++ Sbjct: 66 APLLRSKVAGKFQAVRFAGALFFGVNSAIGYLL 98