BLASTX nr result
ID: Angelica23_contig00017353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00017353 (1080 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543180.1| PREDICTED: nuclear pore complex protein Nup9... 66 2e-08 ref|XP_003543179.1| PREDICTED: nuclear pore complex protein Nup9... 66 2e-08 ref|XP_003539631.1| PREDICTED: uncharacterized protein LOC100789... 66 2e-08 emb|CBI34639.3| unnamed protein product [Vitis vinifera] 64 6e-08 ref|XP_002277144.1| PREDICTED: nuclear pore complex protein Nup9... 64 6e-08 >ref|XP_003543180.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like isoform 2 [Glycine max] Length = 1010 Score = 65.9 bits (159), Expect = 2e-08 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = +3 Query: 618 SFLHVCDKPAPAKSPSLLNIRHLSSHRQRWLPIPKYNPKIDGPKVAFFNDAQKTPTTSRK 797 S + DKPAP + SLL RHLS R R LP+ KY+ K DGPKVAFF+D + TPTT + Sbjct: 684 SSMPALDKPAPVRISSLLTSRHLSQRRIR-LPVRKYHSKNDGPKVAFFSDDEDTPTTPKA 742 Query: 798 EA 803 +A Sbjct: 743 DA 744 >ref|XP_003543179.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like isoform 1 [Glycine max] Length = 1038 Score = 65.9 bits (159), Expect = 2e-08 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = +3 Query: 618 SFLHVCDKPAPAKSPSLLNIRHLSSHRQRWLPIPKYNPKIDGPKVAFFNDAQKTPTTSRK 797 S + DKPAP + SLL RHLS R R LP+ KY+ K DGPKVAFF+D + TPTT + Sbjct: 690 SSMPALDKPAPVRISSLLTSRHLSQRRIR-LPVRKYHSKNDGPKVAFFSDDEDTPTTPKA 748 Query: 798 EA 803 +A Sbjct: 749 DA 750 >ref|XP_003539631.1| PREDICTED: uncharacterized protein LOC100789177 [Glycine max] Length = 1007 Score = 65.9 bits (159), Expect = 2e-08 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = +3 Query: 618 SFLHVCDKPAPAKSPSLLNIRHLSSHRQRWLPIPKYNPKIDGPKVAFFNDAQKTPTTSRK 797 S + DKPAP + SLL RHLS R R LP+ KY+ K DGPKVAFF+D + TPTT + Sbjct: 681 SSMPALDKPAPVRISSLLTSRHLSQRRIR-LPVRKYHSKNDGPKVAFFSDDEDTPTTPKA 739 Query: 798 EA 803 +A Sbjct: 740 DA 741 >emb|CBI34639.3| unnamed protein product [Vitis vinifera] Length = 1047 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/62 (53%), Positives = 42/62 (67%) Frame = +3 Query: 618 SFLHVCDKPAPAKSPSLLNIRHLSSHRQRWLPIPKYNPKIDGPKVAFFNDAQKTPTTSRK 797 S + V DKPAP + SLL RHLS R R LP KY+PK D PKV FF+D ++TP+T + Sbjct: 699 SSMPVVDKPAPVRISSLLTSRHLSQRRIR-LPARKYHPKNDAPKVPFFSDDEETPSTPKA 757 Query: 798 EA 803 +A Sbjct: 758 DA 759 >ref|XP_002277144.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like isoform 1 [Vitis vinifera] Length = 1013 Score = 63.9 bits (154), Expect = 6e-08 Identities = 33/62 (53%), Positives = 42/62 (67%) Frame = +3 Query: 618 SFLHVCDKPAPAKSPSLLNIRHLSSHRQRWLPIPKYNPKIDGPKVAFFNDAQKTPTTSRK 797 S + V DKPAP + SLL RHLS R R LP KY+PK D PKV FF+D ++TP+T + Sbjct: 682 SSMPVVDKPAPVRISSLLTSRHLSQRRIR-LPARKYHPKNDAPKVPFFSDDEETPSTPKA 740 Query: 798 EA 803 +A Sbjct: 741 DA 742