BLASTX nr result
ID: Angelica23_contig00016742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016742 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF65166.2|AF166494_1 putative phloem transcription factor M1... 62 6e-08 >gb|AAF65166.2|AF166494_1 putative phloem transcription factor M1 [Apium graveolens] Length = 353 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -2 Query: 114 AYVQGQGRSQMASQGQVTSQGPPTMSGGGGYLS 16 AYVQGQGRSQM SQGQVTSQG PTMSGGGGYLS Sbjct: 322 AYVQGQGRSQMVSQGQVTSQG-PTMSGGGGYLS 353