BLASTX nr result
ID: Angelica23_contig00016668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016668 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 86 3e-15 ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3... 86 4e-15 ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3... 84 1e-14 emb|CBI29898.3| unnamed protein product [Vitis vinifera] 84 1e-14 emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] 84 1e-14 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +3 Query: 195 IPGDGRCLFRSVVHGACLRTGKPSPTKSLEKELADELRANVVNEF 329 IPGDGRCLFRSVVHGACLR GKPSPT+SLEKELADELRA V +EF Sbjct: 26 IPGDGRCLFRSVVHGACLREGKPSPTESLEKELADELRAKVADEF 70 >ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449522883|ref|XP_004168455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 286 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/51 (72%), Positives = 47/51 (92%) Frame = +3 Query: 177 DLSMISIPGDGRCLFRSVVHGACLRTGKPSPTKSLEKELADELRANVVNEF 329 D S+I IPGDGRCLFRSV HGACLR+GKP+P++SL+++LADELR+NV +EF Sbjct: 137 DYSVIGIPGDGRCLFRSVAHGACLRSGKPAPSESLQRDLADELRSNVADEF 187 >ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3g57810-like [Vitis vinifera] Length = 340 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +3 Query: 177 DLSMISIPGDGRCLFRSVVHGACLRTGKPSPTKSLEKELADELRANVVNEF 329 D S+ IPGDGRCLFRSVVHGACLR+GKP+P+ S ++ELADELRA VV+EF Sbjct: 192 DYSITGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRAEVVDEF 242 >emb|CBI29898.3| unnamed protein product [Vitis vinifera] Length = 189 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +3 Query: 177 DLSMISIPGDGRCLFRSVVHGACLRTGKPSPTKSLEKELADELRANVVNEF 329 D S+ IPGDGRCLFRSVVHGACLR+GKP+P+ S ++ELADELRA VV+EF Sbjct: 41 DYSITGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRAEVVDEF 91 >emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] Length = 806 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +3 Query: 177 DLSMISIPGDGRCLFRSVVHGACLRTGKPSPTKSLEKELADELRANVVNEF 329 D S+ IPGDGRCLFRSVVHGACLR+GKP+P+ S ++ELADELRA VV+EF Sbjct: 658 DYSITGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRAEVVDEF 708