BLASTX nr result
ID: Angelica23_contig00016641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016641 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511207.1| conserved hypothetical protein [Ricinus comm... 93 3e-17 dbj|BAD44310.1| putative protein [Arabidopsis thaliana] 92 6e-17 dbj|BAB08807.1| unnamed protein product [Arabidopsis thaliana] 92 6e-17 ref|NP_201147.2| RNA-metabolising metallo-beta-lactamase family ... 92 6e-17 ref|XP_002318122.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 >ref|XP_002511207.1| conserved hypothetical protein [Ricinus communis] gi|223550322|gb|EEF51809.1| conserved hypothetical protein [Ricinus communis] Length = 880 Score = 92.8 bits (229), Expect = 3e-17 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 64 GRIGSRGPRKRSGRLEGAGKSMEDSVKRIMEHFYEGFDGPPLRVLPIGGLGEIGM 228 G GS+ PRKRSGR+EGAGKSMEDSV+R ME FYEG +GPPLR++PIGGLGEIGM Sbjct: 38 GSHGSKAPRKRSGRMEGAGKSMEDSVQRKMEQFYEGSNGPPLRIVPIGGLGEIGM 92 >dbj|BAD44310.1| putative protein [Arabidopsis thaliana] Length = 911 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 76 SRGPRKRSGRLEGAGKSMEDSVKRIMEHFYEGFDGPPLRVLPIGGLGEIGM 228 S+ PR+RSGRLEG GKSMEDSVKR ME FYEG DGPPLR+LPIGGLGEIGM Sbjct: 73 SKTPRRRSGRLEGVGKSMEDSVKRKMEQFYEGTDGPPLRILPIGGLGEIGM 123 >dbj|BAB08807.1| unnamed protein product [Arabidopsis thaliana] Length = 528 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 76 SRGPRKRSGRLEGAGKSMEDSVKRIMEHFYEGFDGPPLRVLPIGGLGEIGM 228 S+ PR+RSGRLEG GKSMEDSVKR ME FYEG DGPPLR+LPIGGLGEIGM Sbjct: 73 SKTPRRRSGRLEGVGKSMEDSVKRKMEQFYEGTDGPPLRILPIGGLGEIGM 123 >ref|NP_201147.2| RNA-metabolising metallo-beta-lactamase family protein [Arabidopsis thaliana] gi|28393617|gb|AAO42228.1| unknown protein [Arabidopsis thaliana] gi|62319893|dbj|BAD93952.1| putative protein [Arabidopsis thaliana] gi|332010363|gb|AED97746.1| RNA-metabolising metallo-beta-lactamase family protein [Arabidopsis thaliana] Length = 911 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +1 Query: 76 SRGPRKRSGRLEGAGKSMEDSVKRIMEHFYEGFDGPPLRVLPIGGLGEIGM 228 S+ PR+RSGRLEG GKSMEDSVKR ME FYEG DGPPLR+LPIGGLGEIGM Sbjct: 73 SKTPRRRSGRLEGVGKSMEDSVKRKMEQFYEGTDGPPLRILPIGGLGEIGM 123 >ref|XP_002318122.1| predicted protein [Populus trichocarpa] gi|222858795|gb|EEE96342.1| predicted protein [Populus trichocarpa] Length = 890 Score = 89.7 bits (221), Expect = 2e-16 Identities = 45/57 (78%), Positives = 48/57 (84%), Gaps = 4/57 (7%) Frame = +1 Query: 70 IGSRG----PRKRSGRLEGAGKSMEDSVKRIMEHFYEGFDGPPLRVLPIGGLGEIGM 228 IGSRG PRKR+GR EG GKSMEDSVKR ME FYEG DGPPLR++PIGGLGEIGM Sbjct: 38 IGSRGTKAPPRKRTGRKEGTGKSMEDSVKRKMEQFYEGPDGPPLRIVPIGGLGEIGM 94