BLASTX nr result
ID: Angelica23_contig00016523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016523 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550033.1| PREDICTED: nuA4 complex subunit EAF3 homolog... 57 1e-06 ref|XP_002283618.1| PREDICTED: mortality factor 4-like protein 1... 57 1e-06 ref|XP_003524665.1| PREDICTED: nuA4 complex subunit EAF3 homolog... 57 2e-06 >ref|XP_003550033.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max] Length = 319 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 90 SECWDEWVGKDRLMKYTEENVLKQQALDKK 1 S+ WDEWVG++RLMK+TEENVLKQQALDKK Sbjct: 68 SKNWDEWVGEERLMKHTEENVLKQQALDKK 97 >ref|XP_002283618.1| PREDICTED: mortality factor 4-like protein 1 [Vitis vinifera] gi|296087392|emb|CBI33766.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 81 WDEWVGKDRLMKYTEENVLKQQALDKK 1 WDEWVG DRLMK+TEENVLKQQALDKK Sbjct: 73 WDEWVGMDRLMKHTEENVLKQQALDKK 99 >ref|XP_003524665.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max] Length = 319 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 90 SECWDEWVGKDRLMKYTEENVLKQQALDKK 1 S+ WDEWVG++RLMK+TEENV+KQQALDKK Sbjct: 68 SKNWDEWVGEERLMKHTEENVMKQQALDKK 97