BLASTX nr result
ID: Angelica23_contig00016475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016475 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001235369.1| guanine nucleotide-binding protein subunit b... 75 4e-12 gb|ACV72060.1| RACK1 [Phaseolus vulgaris] 75 4e-12 gb|ACJ24167.1| Rack [Phaseolus vulgaris] 75 4e-12 sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding ... 75 5e-12 sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding ... 74 9e-12 >ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein [Glycine max] gi|3023858|sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|1256608|gb|AAB05941.1| G beta-like protein [Glycine max] Length = 325 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 119 NA K KVIYCTSLNWSADGSTLFSGYTDGV RVW+I R+ Sbjct: 287 NANKKKVIYCTSLNWSADGSTLFSGYTDGVARVWAIGRY 325 >gb|ACV72060.1| RACK1 [Phaseolus vulgaris] Length = 324 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 119 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >gb|ACJ24167.1| Rack [Phaseolus vulgaris] Length = 324 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 NAGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 119 N K KVIYCTSLNWSADGSTLFSGYTDGVVRVW+I R+ Sbjct: 286 NTNKKKVIYCTSLNWSADGSTLFSGYTDGVVRVWAIGRY 324 >sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|1695181|emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia] Length = 326 Score = 75.1 bits (183), Expect = 5e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 6 AGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 119 +GKNKVIYCTSL WSADGSTLFSGYTDG++RVW I RF Sbjct: 289 SGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRF 326 >sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|402538|dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum] Length = 326 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 6 AGKNKVIYCTSLNWSADGSTLFSGYTDGVVRVWSISRF 119 +GKNKVIYCTSL+WSADGSTLFSGYTDG++RVW I R+ Sbjct: 289 SGKNKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIDRY 326