BLASTX nr result
ID: Angelica23_contig00016420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016420 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510125.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002510125.1| conserved hypothetical protein [Ricinus communis] gi|223550826|gb|EEF52312.1| conserved hypothetical protein [Ricinus communis] Length = 470 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = +2 Query: 2 IPPAEIRYSSSSEACEVPPKGRVKPPVTNAAYRAKVAATNR 124 IPPAE+R++S SE CE+P R+KPPV A YR KV A +R Sbjct: 420 IPPAELRFASISETCELPQAQRIKPPVAAATYRTKVVALDR 460