BLASTX nr result
ID: Angelica23_contig00016314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016314 (1054 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002883568.1| hypothetical protein ARALYDRAFT_480010 [Arab... 91 5e-16 ref|NP_189139.1| RING/U-box domain-containing protein [Arabidops... 91 5e-16 ref|NP_849372.2| RING/U-box domain-containing protein [Arabidops... 91 6e-16 ref|NP_001190713.1| RING/U-box domain-containing protein [Arabid... 91 6e-16 ref|XP_002863174.1| zinc finger family protein [Arabidopsis lyra... 91 6e-16 >ref|XP_002883568.1| hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. lyrata] gi|297329408|gb|EFH59827.1| hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 90.9 bits (224), Expect = 5e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 794 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 922 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 205 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 247 >ref|NP_189139.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|79313365|ref|NP_001030762.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|9293985|dbj|BAB01888.1| unnamed protein product [Arabidopsis thaliana] gi|48958487|gb|AAT47796.1| At3g25030 [Arabidopsis thaliana] gi|51536564|gb|AAU05520.1| At3g25030 [Arabidopsis thaliana] gi|332643448|gb|AEE76969.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332643449|gb|AEE76970.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 250 Score = 90.9 bits (224), Expect = 5e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 794 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 922 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT ILE+LD+F Sbjct: 208 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF 250 >ref|NP_849372.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332657832|gb|AEE83232.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 265 Score = 90.5 bits (223), Expect = 6e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 794 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 922 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 223 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 265 >ref|NP_001190713.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332657834|gb|AEE83234.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 256 Score = 90.5 bits (223), Expect = 6e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 794 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 922 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 214 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 256 >ref|XP_002863174.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297309008|gb|EFH39433.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 259 Score = 90.5 bits (223), Expect = 6e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 794 RNKGSAFIPCGHTFCRLCSRELWVKRGNCPLCNTKILEILDIF 922 R+KG+AFIPCGHTFCRLCSRELWV+RGNCPLCNT IL++LDIF Sbjct: 217 RSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF 259