BLASTX nr result
ID: Angelica23_contig00016201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00016201 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37626.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002272192.1| PREDICTED: uncharacterized protein LOC100259... 64 2e-08 ref|XP_002864917.1| hypothetical protein ARALYDRAFT_919795 [Arab... 60 2e-07 ref|NP_201276.1| Putative endonuclease or glycosyl hydrolase [Ar... 59 5e-07 gb|AAL91288.1| AT5g64710/MVP7_3 [Arabidopsis thaliana] 59 5e-07 >emb|CBI37626.3| unnamed protein product [Vitis vinifera] Length = 871 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +3 Query: 195 RRHEDESRLVRVLVWWDFENCALPKGNYAYRLAQFITSAVRTN 323 RRHEDESR V+V VWWDFENC +P G +++A IT+AVR N Sbjct: 41 RRHEDESRTVKVSVWWDFENCNIPAGVNVFKIAHSITAAVRAN 83 >ref|XP_002272192.1| PREDICTED: uncharacterized protein LOC100259153 [Vitis vinifera] Length = 990 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +3 Query: 195 RRHEDESRLVRVLVWWDFENCALPKGNYAYRLAQFITSAVRTN 323 RRHEDESR V+V VWWDFENC +P G +++A IT+AVR N Sbjct: 41 RRHEDESRTVKVSVWWDFENCNIPAGVNVFKIAHSITAAVRAN 83 >ref|XP_002864917.1| hypothetical protein ARALYDRAFT_919795 [Arabidopsis lyrata subsp. lyrata] gi|297310752|gb|EFH41176.1| hypothetical protein ARALYDRAFT_919795 [Arabidopsis lyrata subsp. lyrata] Length = 860 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 2/43 (4%) Frame = +3 Query: 195 RRH--EDESRLVRVLVWWDFENCALPKGNYAYRLAQFITSAVR 317 RRH E+ESR VRV VWWDFENC LP G ++LAQ ITSA+R Sbjct: 49 RRHQYEEESRSVRVHVWWDFENCHLPSGANVFKLAQTITSAIR 91 >ref|NP_201276.1| Putative endonuclease or glycosyl hydrolase [Arabidopsis thaliana] gi|10177202|dbj|BAB10304.1| unnamed protein product [Arabidopsis thaliana] gi|332010558|gb|AED97941.1| Putative endonuclease or glycosyl hydrolase [Arabidopsis thaliana] Length = 841 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 198 RHEDESRLVRVLVWWDFENCALPKGNYAYRLAQFITSAVR 317 ++E++SR VRV VWWDFENC LP G ++LAQ ITSAVR Sbjct: 52 QYEEDSRSVRVPVWWDFENCHLPSGANVFKLAQTITSAVR 91 >gb|AAL91288.1| AT5g64710/MVP7_3 [Arabidopsis thaliana] Length = 841 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +3 Query: 198 RHEDESRLVRVLVWWDFENCALPKGNYAYRLAQFITSAVR 317 ++E++SR VRV VWWDFENC LP G ++LAQ ITSAVR Sbjct: 52 QYEEDSRSVRVPVWWDFENCHLPSGANVFKLAQTITSAVR 91