BLASTX nr result
ID: Angelica23_contig00015210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00015210 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD91200.1| sodium proton antiporter [Ipomoea nil] gi|616755... 58 7e-07 dbj|BAB56107.1| Na H-antiportor [Torenia hybrida] 56 3e-06 >dbj|BAD91200.1| sodium proton antiporter [Ipomoea nil] gi|61675572|dbj|BAD91201.1| sodium proton antiporter [Ipomoea nil] Length = 536 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -3 Query: 374 FMRPVFGGRGFVQYVPGSPTEQSVPQWE 291 FMRPVFGGRGFV YVPGSPTEQ+ PQW+ Sbjct: 509 FMRPVFGGRGFVPYVPGSPTEQNEPQWQ 536 >dbj|BAB56107.1| Na H-antiportor [Torenia hybrida] Length = 555 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 374 FMRPVFGGRGFVQYVPGSPTEQSVPQWE*E 285 FMRPVFGGRGFV YVPGSPTE+SV WE E Sbjct: 523 FMRPVFGGRGFVPYVPGSPTERSVRNWEEE 552