BLASTX nr result
ID: Angelica23_contig00014797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00014797 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530585.1| nascent polypeptide associated complex alpha... 72 4e-11 >ref|XP_002530585.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] gi|223529884|gb|EEF31815.1| nascent polypeptide associated complex alpha subunit, putative [Ricinus communis] Length = 687 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/101 (34%), Positives = 64/101 (63%) Frame = -3 Query: 307 FLLFWAFEYLNISRPEHAEGDGNVFPRARRWMFAENLGTLDNSELTASRFQLDYVDDEAQ 128 FLL WA+E++ RP D ++FPRAR+W + + ++++ T R +L+Y++++ + Sbjct: 430 FLLLWAYEHIPYQRPL-TNFDPDIFPRARQWDLTK-MDVPNSNDFTWYRLELEYLEED-E 486 Query: 127 VTWEPYLDCETYNGIEHSIALSKSRVRFMSLDTWEYYLGER 5 V ++PY G+E+ LS+ R+ F+ L++WE Y+GER Sbjct: 487 VNFDPYGKLWEEEGLEYERELSQKRIAFLGLESWELYMGER 527