BLASTX nr result
ID: Angelica23_contig00014791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00014791 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15021.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_002282612.1| PREDICTED: 50S ribosomal protein L12, chloro... 77 2e-12 gb|ABA40429.1| unknown [Solanum tuberosum] 70 2e-10 ref|XP_004170687.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosoma... 66 3e-09 ref|XP_004152013.1| PREDICTED: 50S ribosomal protein L12, chloro... 66 3e-09 >emb|CBI15021.3| unnamed protein product [Vitis vinifera] Length = 91 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 154 MKVISLVRSIRSRPILPTVLGSLQTRSFQPDFVPRDPNAKPKRYKYPKFYD 2 MK +LV+++R P LP ++G LQ+R FQ DFVPR+PNAKPKRYKYP FYD Sbjct: 1 MKFTALVKTVRVHPTLPKIIGPLQSRFFQHDFVPREPNAKPKRYKYPPFYD 51 >ref|XP_002282612.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Vitis vinifera] Length = 193 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 154 MKVISLVRSIRSRPILPTVLGSLQTRSFQPDFVPRDPNAKPKRYKYPKFYD 2 MK +LV+++R P LP ++G LQ+R FQ DFVPR+PNAKPKRYKYP FYD Sbjct: 1 MKFTALVKTVRVHPTLPKIIGPLQSRFFQHDFVPREPNAKPKRYKYPPFYD 51 >gb|ABA40429.1| unknown [Solanum tuberosum] Length = 194 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = -3 Query: 154 MKVISLVRSIRSRPILPTVLGSLQTRSFQPDFVPRDPNAKPKRYKYPKFYD 2 MK+I+ +R I++ L ++G LQ+RSFQPDFVPRDPNAKP RYKYP YD Sbjct: 1 MKLIARLRPIQTCTALREIIGPLQSRSFQPDFVPRDPNAKPIRYKYPAAYD 51 >ref|XP_004170687.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L12, chloroplastic-like [Cucumis sativus] Length = 193 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 154 MKVISLVRSIRSRPILPTVLGSLQTRSFQPDFVPRDPNAKPKRYKYPKFYD 2 MK+ + +S++ R ++G Q R FQPDF PRDPNAKPK+YKYP FYD Sbjct: 1 MKLTVVAQSLQVRSTFAKIIGLSQVRFFQPDFTPRDPNAKPKKYKYPAFYD 51 >ref|XP_004152013.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Cucumis sativus] Length = 193 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -3 Query: 154 MKVISLVRSIRSRPILPTVLGSLQTRSFQPDFVPRDPNAKPKRYKYPKFYD 2 MK+ + +S++ R ++G Q R FQPDF PRDPNAKPK+YKYP FYD Sbjct: 1 MKLTVVAQSLQVRSTFAKIIGLSQVRFFQPDFTPRDPNAKPKKYKYPAFYD 51