BLASTX nr result
ID: Angelica23_contig00014458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00014458 (589 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD43850.1| cell division cycle protein 2 [Daucus carota] 117 2e-33 gb|AAC41680.1| protein kinase p34cdc2 [Petroselinum crispum] 110 1e-30 dbj|BAE80323.1| cyclin dependent kinase A [Camellia sinensis] 103 2e-28 ref|XP_003546294.1| PREDICTED: cell division control protein 2 h... 108 2e-28 ref|NP_001240016.1| cell division control protein 2 homolog [Gly... 108 2e-28 >emb|CAD43850.1| cell division cycle protein 2 [Daucus carota] Length = 294 Score = 117 bits (294), Expect(2) = 2e-33 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +1 Query: 1 RIVGTPNEDTWPGVTSLPDFKSAFPKWPSKELGNVVPNLDLAGLNLLKKMLCLDP 165 RIVGTPNEDTWPGVT+LPDFKSAFPKWPSKELGNVVPNLD+AGLNLLKKMLCLDP Sbjct: 218 RIVGTPNEDTWPGVTALPDFKSAFPKWPSKELGNVVPNLDVAGLNLLKKMLCLDP 272 Score = 50.1 bits (118), Expect(2) = 2e-33 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 224 PSRRITARSALEHEYFKDIGIVP 292 PSRRITARSALEHEYFKDIGIVP Sbjct: 272 PSRRITARSALEHEYFKDIGIVP 294 >gb|AAC41680.1| protein kinase p34cdc2 [Petroselinum crispum] Length = 294 Score = 110 bits (276), Expect(2) = 1e-30 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +1 Query: 1 RIVGTPNEDTWPGVTSLPDFKSAFPKWPSKELGNVVPNLDLAGLNLLKKMLCLDP 165 RI GTPNEDTWPGVTSLPDFKSAFPKWPSKEL VVPNLD AGLNLLKKMLCLDP Sbjct: 218 RITGTPNEDTWPGVTSLPDFKSAFPKWPSKELETVVPNLDSAGLNLLKKMLCLDP 272 Score = 47.8 bits (112), Expect(2) = 1e-30 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +2 Query: 224 PSRRITARSALEHEYFKDIGIVP 292 PSRRITAR ALEHEYFKDIGIVP Sbjct: 272 PSRRITARIALEHEYFKDIGIVP 294 >dbj|BAE80323.1| cyclin dependent kinase A [Camellia sinensis] Length = 294 Score = 103 bits (256), Expect(2) = 2e-28 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +1 Query: 1 RIVGTPNEDTWPGVTSLPDFKSAFPKWPSKELGNVVPNLDLAGLNLLKKMLCLDP 165 RI+GTPNEDTWPGVTSL DFKSAFPKWPSK+L VVPNLD AG++LL KMLCLDP Sbjct: 218 RILGTPNEDTWPGVTSLADFKSAFPKWPSKDLATVVPNLDSAGIDLLSKMLCLDP 272 Score = 48.5 bits (114), Expect(2) = 2e-28 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +2 Query: 224 PSRRITARSALEHEYFKDIGIVP 292 PSRRITARSALEHEYFKDIG VP Sbjct: 272 PSRRITARSALEHEYFKDIGFVP 294 >ref|XP_003546294.1| PREDICTED: cell division control protein 2 homolog [Glycine max] Length = 294 Score = 108 bits (269), Expect(2) = 2e-28 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +1 Query: 1 RIVGTPNEDTWPGVTSLPDFKSAFPKWPSKELGNVVPNLDLAGLNLLKKMLCLDP 165 RI+GTPNEDTWPGVTSLPDFKS FPKWPSK+L NVVPNLD AGLNLL MLCLDP Sbjct: 218 RILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDP 272 Score = 43.1 bits (100), Expect(2) = 2e-28 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +2 Query: 224 PSRRITARSALEHEYFKDIGIVP 292 PS+RITARSA+EHEYFKDI VP Sbjct: 272 PSKRITARSAVEHEYFKDIKFVP 294 >ref|NP_001240016.1| cell division control protein 2 homolog [Glycine max] gi|336390563|gb|AEI54341.1| serine threonine tyrosine kinase [Glycine max] Length = 294 Score = 108 bits (269), Expect(2) = 2e-28 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +1 Query: 1 RIVGTPNEDTWPGVTSLPDFKSAFPKWPSKELGNVVPNLDLAGLNLLKKMLCLDP 165 RI+GTPNEDTWPGVTSLPDFKS FPKWPSK+L NVVPNLD AGLNLL MLCLDP Sbjct: 218 RILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDP 272 Score = 43.1 bits (100), Expect(2) = 2e-28 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +2 Query: 224 PSRRITARSALEHEYFKDIGIVP 292 PS+RITARSA+EHEYFKDI VP Sbjct: 272 PSKRITARSAVEHEYFKDIKFVP 294