BLASTX nr result
ID: Angelica23_contig00014244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00014244 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA46767.1| unknown [Solanum tuberosum] 70 2e-10 tpg|DAA55417.1| TPA: hypothetical protein ZEAMMB73_005048 [Zea m... 70 2e-10 tpg|DAA41535.1| TPA: hypothetical protein ZEAMMB73_424707 [Zea m... 70 2e-10 gb|AEX13009.1| hypothetical protein CL240Contig1_05 [Pinus taeda... 70 2e-10 ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [... 70 2e-10 >gb|ABA46767.1| unknown [Solanum tuberosum] Length = 197 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 157 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 249 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK Sbjct: 1 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 31 >tpg|DAA55417.1| TPA: hypothetical protein ZEAMMB73_005048 [Zea mays] Length = 169 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 157 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 249 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK Sbjct: 1 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 31 >tpg|DAA41535.1| TPA: hypothetical protein ZEAMMB73_424707 [Zea mays] Length = 243 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 157 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 249 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK Sbjct: 1 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 31 >gb|AEX13009.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067813|gb|AEX13010.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067815|gb|AEX13011.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067817|gb|AEX13012.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067819|gb|AEX13013.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067821|gb|AEX13014.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067823|gb|AEX13015.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067825|gb|AEX13016.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067827|gb|AEX13017.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067829|gb|AEX13018.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067831|gb|AEX13019.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067833|gb|AEX13020.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067835|gb|AEX13021.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067837|gb|AEX13022.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067839|gb|AEX13023.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067841|gb|AEX13024.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067843|gb|AEX13025.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067845|gb|AEX13026.1| hypothetical protein CL240Contig1_05 [Pinus taeda] gi|367067847|gb|AEX13027.1| hypothetical protein CL240Contig1_05 [Pinus radiata] gi|376339119|gb|AFB34088.1| hypothetical protein CL240Contig1_05, partial [Pinus mugo] gi|376339121|gb|AFB34089.1| hypothetical protein CL240Contig1_05, partial [Pinus mugo] Length = 70 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 157 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 249 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK Sbjct: 4 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 34 >ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon] Length = 195 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 157 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 249 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK Sbjct: 1 MVHVNFYRNYGKTFKKPRRPYEKERLDAELK 31