BLASTX nr result
ID: Angelica23_contig00014201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00014201 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 99 2e-37 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 99 2e-37 ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 98 3e-37 ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 99 3e-37 ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ri... 97 3e-37 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] Length = 183 Score = 99.4 bits (246), Expect(2) = 2e-37 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 118 LVNVFEVFLPQLLFYPNPADPFNGEAAALMMRDRASYEQRVKEYCEKYAK 267 LVNVFEVFLPQLL YPNP+DP NGEAAALMMRDRA+YEQRVKEYCEKYAK Sbjct: 99 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVKEYCEKYAK 148 Score = 81.6 bits (200), Expect(2) = 2e-37 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 PYHGGVWRIRVELRDAYPYKSPSIGFINKIYHPNVDEI 116 PYHGGVW++RVEL DAYPYKSPSIGFINKIYHPNVDE+ Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 80 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 99.4 bits (246), Expect(2) = 2e-37 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 118 LVNVFEVFLPQLLFYPNPADPFNGEAAALMMRDRASYEQRVKEYCEKYAK 267 LVNVFEVFLPQLL YPNP+DP NGEAAALMMRDRA+YEQRVKEYCEKYAK Sbjct: 99 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVKEYCEKYAK 148 Score = 81.6 bits (200), Expect(2) = 2e-37 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 PYHGGVWRIRVELRDAYPYKSPSIGFINKIYHPNVDEI 116 PYHGGVW++RVEL DAYPYKSPSIGFINKIYHPNVDE+ Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 80 >ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Vitis vinifera] gi|147789691|emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera] gi|297745317|emb|CBI40397.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 97.8 bits (242), Expect(2) = 3e-37 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 118 LVNVFEVFLPQLLFYPNPADPFNGEAAALMMRDRASYEQRVKEYCEKYAK 267 LVNVFEVFLPQLL YPNP+DP NGEAAALMMRDR +YEQRVKEYCEKYAK Sbjct: 99 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEYCEKYAK 148 Score = 82.8 bits (203), Expect(2) = 3e-37 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 3 PYHGGVWRIRVELRDAYPYKSPSIGFINKIYHPNVDEI 116 PYHGGVWRIRVEL DAYPYKSPSIGF+NKIYHPNVDE+ Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHPNVDEM 80 >ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 98.6 bits (244), Expect(2) = 3e-37 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +1 Query: 118 LVNVFEVFLPQLLFYPNPADPFNGEAAALMMRDRASYEQRVKEYCEKYAK 267 LVNVFEVFLPQLL YPNP+DP NGEAAALMMRDR SYEQRVKEYCEKYAK Sbjct: 99 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQRVKEYCEKYAK 148 Score = 81.6 bits (200), Expect(2) = 3e-37 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 PYHGGVWRIRVELRDAYPYKSPSIGFINKIYHPNVDEI 116 PYHGGVW++RVEL DAYPYKSPSIGFINKIYHPNVDE+ Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEM 80 >ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] gi|223549063|gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] Length = 183 Score = 97.4 bits (241), Expect(2) = 3e-37 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 118 LVNVFEVFLPQLLFYPNPADPFNGEAAALMMRDRASYEQRVKEYCEKYAK 267 LVNVFEVFLPQLL YPNP+DP NGEAAALMMRDR +YEQRVKEYCEKYAK Sbjct: 99 LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVKEYCEKYAK 148 Score = 82.8 bits (203), Expect(2) = 3e-37 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 3 PYHGGVWRIRVELRDAYPYKSPSIGFINKIYHPNVDEI 116 PYHGGVWRIRVEL DAYPYKSPSIGF+NKIYHPNVDE+ Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHPNVDEM 80