BLASTX nr result
ID: Angelica23_contig00013895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00013895 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521222.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002305164.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 gb|AAF98216.1|AC007152_12 Unknown protein [Arabidopsis thaliana] 59 3e-07 ref|NP_564889.1| abscisic acid (aba)-deficient 4 protein [Arabid... 59 3e-07 ref|XP_002888575.1| hypothetical protein ARALYDRAFT_894432 [Arab... 59 4e-07 >ref|XP_002521222.1| conserved hypothetical protein [Ricinus communis] gi|223539587|gb|EEF41174.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 121 IMFLLNLYTLQLSGIAKMFSSELTLASAWIHLLAVDLFAAR 243 +MF + +L GIAKMFSSE+TLASAWIHLLAVDLFAAR Sbjct: 158 LMFASQYWLPELPGIAKMFSSEMTLASAWIHLLAVDLFAAR 198 >ref|XP_002305164.1| predicted protein [Populus trichocarpa] gi|222848128|gb|EEE85675.1| predicted protein [Populus trichocarpa] Length = 246 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 121 IMFLLNLYTLQLSGIAKMFSSELTLASAWIHLLAVDLFAAR 243 +MF + +L GIAKMFS+E+TLASAWIHLLAVDLFAAR Sbjct: 158 LMFASQYWLPELPGIAKMFSNEMTLASAWIHLLAVDLFAAR 198 >gb|AAF98216.1|AC007152_12 Unknown protein [Arabidopsis thaliana] Length = 203 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +1 Query: 91 LEFVFEMKPMIMFLLNLYTLQLSGIAKMFSSELTLASAWIHLLAVDLFAAR 243 L+++F K M+ +LSGIAKMFSSE+TLASAWIHLL VDLFAAR Sbjct: 118 LKYMFSSKYMLP--------ELSGIAKMFSSEMTLASAWIHLLVVDLFAAR 160 >ref|NP_564889.1| abscisic acid (aba)-deficient 4 protein [Arabidopsis thaliana] gi|21536950|gb|AAM61291.1| unknown [Arabidopsis thaliana] gi|51969250|dbj|BAD43317.1| unknown protein [Arabidopsis thaliana] gi|88196719|gb|ABD43002.1| At1g67080 [Arabidopsis thaliana] gi|332196472|gb|AEE34593.1| abscisic acid (aba)-deficient 4 protein [Arabidopsis thaliana] Length = 220 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +1 Query: 91 LEFVFEMKPMIMFLLNLYTLQLSGIAKMFSSELTLASAWIHLLAVDLFAAR 243 L+++F K M+ +LSGIAKMFSSE+TLASAWIHLL VDLFAAR Sbjct: 135 LKYMFSSKYMLP--------ELSGIAKMFSSEMTLASAWIHLLVVDLFAAR 177 >ref|XP_002888575.1| hypothetical protein ARALYDRAFT_894432 [Arabidopsis lyrata subsp. lyrata] gi|297334416|gb|EFH64834.1| hypothetical protein ARALYDRAFT_894432 [Arabidopsis lyrata subsp. lyrata] Length = 224 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +1 Query: 91 LEFVFEMKPMIMFLLNLYTLQLSGIAKMFSSELTLASAWIHLLAVDLFAAR 243 L+++F K M+ +LSGIAKMFSSE+TLASAWIHLL +DLFAAR Sbjct: 139 LKYMFSSKYMLP--------ELSGIAKMFSSEMTLASAWIHLLVIDLFAAR 181