BLASTX nr result
ID: Angelica23_contig00013734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00013734 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly pro... 63 2e-08 ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly pro... 63 2e-08 ref|XP_003537435.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome c... 63 2e-08 ref|XP_002528151.1| cytochrome C oxidase assembly protein cox11,... 63 2e-08 ref|XP_002297920.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 >ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] gi|449521983|ref|XP_004168008.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Cucumis sativus] Length = 333 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 366 RVKPGESELAFYTAKN*SSTPITGMSTYNVTPMK 265 RVKPGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 240 RVKPGESALAFYTAENRSSTPITGVSTYNVTPMK 273 >ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Glycine max] Length = 284 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 366 RVKPGESELAFYTAKN*SSTPITGMSTYNVTPMK 265 RVKPGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 191 RVKPGESALAFYTAENKSSTPITGVSTYNVTPMK 224 >ref|XP_003537435.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Glycine max] Length = 182 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 366 RVKPGESELAFYTAKN*SSTPITGMSTYNVTPMK 265 RVKPGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 121 RVKPGESALAFYTAENKSSTPITGVSTYNVTPMK 154 >ref|XP_002528151.1| cytochrome C oxidase assembly protein cox11, putative [Ricinus communis] gi|223532449|gb|EEF34242.1| cytochrome C oxidase assembly protein cox11, putative [Ricinus communis] Length = 199 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 366 RVKPGESELAFYTAKN*SSTPITGMSTYNVTPMKMMCLSKR 244 RVKPGES LAFYTA+N S TPITG+STYNVTPMK+ L R Sbjct: 157 RVKPGESALAFYTAENRSKTPITGVSTYNVTPMKINFLVSR 197 >ref|XP_002297920.1| predicted protein [Populus trichocarpa] gi|222845178|gb|EEE82725.1| predicted protein [Populus trichocarpa] Length = 183 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 366 RVKPGESELAFYTAKN*SSTPITGMSTYNVTPMK 265 RVKPGES LAFYTA+N SSTPITG+STYNVTPMK Sbjct: 90 RVKPGESALAFYTAENRSSTPITGVSTYNVTPMK 123