BLASTX nr result
ID: Angelica23_contig00013310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00013310 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS32302.1| trans-2-enoyl CoA reductase [Jatropha curcas] 54 1e-05 >gb|ACS32302.1| trans-2-enoyl CoA reductase [Jatropha curcas] Length = 380 Score = 54.3 bits (129), Expect = 1e-05 Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 9/66 (13%) Frame = +1 Query: 46 MASSCLFKSLTLK----PYSPSILMN----HFPNLKFT-VRSFSAAMSPPSTAVMYDQEG 198 MAS + +S +K P+S S+L N H P + VR+FSA MSPPS AV+YDQ+G Sbjct: 1 MASMMMMRSTAMKVLNEPFS-SLLFNLKWGHIPRAQAQIVRTFSAFMSPPSKAVVYDQQG 59 Query: 199 PPDSVT 216 PPDSVT Sbjct: 60 PPDSVT 65