BLASTX nr result
ID: Angelica23_contig00013230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00013230 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +3 Query: 93 LAHSKYGAVPWALGEGLELMVIKAEGTAIGWLHRAATTFLSCRWKDNMLVL 245 LA SK P LGEG M +AEGTA+GW HRAA T LS +WKDN VL Sbjct: 4 LARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVL 54