BLASTX nr result
ID: Angelica23_contig00012384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00012384 (514 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140748.1| PREDICTED: probable NADH dehydrogenase [ubiq... 62 5e-08 ref|XP_002513634.1| NADH dehydrogenase, putative [Ricinus commun... 61 1e-07 ref|XP_002864198.1| hypothetical protein ARALYDRAFT_495348 [Arab... 58 9e-07 ref|XP_002276087.1| PREDICTED: probable NADH dehydrogenase [ubiq... 58 9e-07 ref|NP_680745.1| uncharacterized protein [Arabidopsis thaliana] ... 57 2e-06 >ref|XP_004140748.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial-like [Cucumis sativus] gi|449485470|ref|XP_004157179.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial-like [Cucumis sativus] Length = 168 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 2 DAPVPKHVPLHRPGPLPEEFYKTLETITTGTLEDITIKKK 121 DAPVPKH+PLHRPGPLPEEFYKTLE I+ + + + +K Sbjct: 123 DAPVPKHIPLHRPGPLPEEFYKTLEAISGDSTKKVETPEK 162 >ref|XP_002513634.1| NADH dehydrogenase, putative [Ricinus communis] gi|223547542|gb|EEF49037.1| NADH dehydrogenase, putative [Ricinus communis] Length = 166 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +2 Query: 2 DAPVPKHVPLHRPGPLPEEFYKTLETITTGTLEDIT 109 DAPVPKHVPLHRPGPLPEEFYKTLE + + +T Sbjct: 123 DAPVPKHVPLHRPGPLPEEFYKTLEAVQSKDAPAVT 158 >ref|XP_002864198.1| hypothetical protein ARALYDRAFT_495348 [Arabidopsis lyrata subsp. lyrata] gi|297310033|gb|EFH40457.1| hypothetical protein ARALYDRAFT_495348 [Arabidopsis lyrata subsp. lyrata] Length = 169 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +2 Query: 2 DAPVPKHVPLHRPGPLPEEFYKTLETITTGTLEDI-TIKKKDPSI 133 DAP+PKHVP HRPGPLPEEFYKTLE + + +I DP + Sbjct: 123 DAPIPKHVPQHRPGPLPEEFYKTLEGLLAESKTEIPAASSSDPQL 167 >ref|XP_002276087.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Vitis vinifera] gi|302143765|emb|CBI22626.3| unnamed protein product [Vitis vinifera] Length = 169 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 2 DAPVPKHVPLHRPGPLPEEFYKTLETIT 85 DAP+PKHVP HRPGPLPEEFY TLE +T Sbjct: 123 DAPIPKHVPQHRPGPLPEEFYNTLEAVT 150 >ref|NP_680745.1| uncharacterized protein [Arabidopsis thaliana] gi|332660019|gb|AEE85419.1| uncharacterized protein [Arabidopsis thaliana] Length = 115 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/44 (54%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 5 APVPKHVPLHRPGPLPEEFYKTLETITTGTLEDIT-IKKKDPSI 133 AP+PKHVP HRPGPLPEEFY+TL+ + + + +IT DP + Sbjct: 70 APIPKHVPHHRPGPLPEEFYRTLQAVNSESKTEITATSSSDPQL 113