BLASTX nr result
ID: Angelica23_contig00012225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00012225 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 80 2e-13 ref|XP_003550164.1| PREDICTED: transcriptional corepressor LEUNI... 80 2e-13 ref|XP_003550163.1| PREDICTED: transcriptional corepressor LEUNI... 80 2e-13 ref|XP_003544623.1| PREDICTED: transcriptional corepressor LEUNI... 80 2e-13 ref|XP_003544622.1| PREDICTED: transcriptional corepressor LEUNI... 80 2e-13 >emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] Length = 915 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 187 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 300 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV Sbjct: 1 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 38 >ref|XP_003550164.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 [Glycine max] Length = 912 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 187 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 300 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV Sbjct: 1 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 38 >ref|XP_003550163.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 [Glycine max] Length = 903 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 187 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 300 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV Sbjct: 1 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 38 >ref|XP_003544623.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 [Glycine max] Length = 893 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 187 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 300 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV Sbjct: 1 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 38 >ref|XP_003544622.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 [Glycine max] Length = 902 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 187 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 300 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV Sbjct: 1 MSQTNWEADKMLDVYIHDYLVKRDLKASAQAFQAEGKV 38