BLASTX nr result
ID: Angelica23_contig00012186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00012186 (544 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791... 62 8e-08 >ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791461 [Glycine max] Length = 41 Score = 61.6 bits (148), Expect = 8e-08 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +1 Query: 229 MEKICLWSDCFQNRFLLFQEVLDLRYLILGEFVPISFVNCT 351 ME +C W++C+Q RF FQEVLD R ILG+F+ +SFVNCT Sbjct: 1 MEGVCFWTNCYQYRFFAFQEVLDWRVFILGDFLRVSFVNCT 41