BLASTX nr result
ID: Angelica23_contig00012182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00012182 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_176447.1| pentatricopeptide repeat-containing protein [Ar... 92 3e-17 gb|AAG52154.1|AC022355_15 unknown protein; 19199-17308 [Arabidop... 92 3e-17 ref|NP_176522.2| pentatricopeptide repeat-containing protein [Ar... 92 3e-17 gb|AAM97065.1| putative membrane-associated salt-inducible prote... 92 3e-17 ref|NP_176529.1| pentatricopeptide repeat-containing protein [Ar... 89 4e-16 >ref|NP_176447.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213223|sp|Q9SXD8.1|PPR90_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g62590 gi|5454201|gb|AAD43616.1|AC005698_15 T3P18.15 [Arabidopsis thaliana] gi|332195860|gb|AEE33981.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 634 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/71 (59%), Positives = 53/71 (74%) Frame = +3 Query: 3 NTIIDCLCKHRLVDQALGLLHEMTKKGITPNVITYSSLIQGMCDFNRWQDVNQLLSEMVK 182 NTIID LCK+R VD AL L EM KGI PNV+TYSSLI +C + RW D +QLLS+M++ Sbjct: 264 NTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIE 323 Query: 183 RNISPNVYTSN 215 + I+PN+ T N Sbjct: 324 KKINPNLVTFN 334 >gb|AAG52154.1|AC022355_15 unknown protein; 19199-17308 [Arabidopsis thaliana] Length = 558 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/71 (59%), Positives = 53/71 (74%) Frame = +3 Query: 3 NTIIDCLCKHRLVDQALGLLHEMTKKGITPNVITYSSLIQGMCDFNRWQDVNQLLSEMVK 182 NTIID LCK+R VD AL L EM KGI PNV+TYSSLI +C + RW D +QLLS+M++ Sbjct: 188 NTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIE 247 Query: 183 RNISPNVYTSN 215 + I+PN+ T N Sbjct: 248 KKINPNLVTFN 258 >ref|NP_176522.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806282|sp|Q9C8T7.2|PP101_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63330 gi|332195966|gb|AEE34087.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 559 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/71 (59%), Positives = 53/71 (74%) Frame = +3 Query: 3 NTIIDCLCKHRLVDQALGLLHEMTKKGITPNVITYSSLIQGMCDFNRWQDVNQLLSEMVK 182 NTIID LCK+R VD AL L EM KGI PNV+TYSSLI +C + RW D +QLLS+M++ Sbjct: 189 NTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIE 248 Query: 183 RNISPNVYTSN 215 + I+PN+ T N Sbjct: 249 KKINPNLVTFN 259 >gb|AAM97065.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] gi|62320656|dbj|BAD95323.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] Length = 596 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/71 (59%), Positives = 53/71 (74%) Frame = +3 Query: 3 NTIIDCLCKHRLVDQALGLLHEMTKKGITPNVITYSSLIQGMCDFNRWQDVNQLLSEMVK 182 NTIID LCK+R VD AL L EM KGI PNV+TYSSLI +C + RW D +QLLS+M++ Sbjct: 226 NTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIE 285 Query: 183 RNISPNVYTSN 215 + I+PN+ T N Sbjct: 286 KKINPNLVTFN 296 >ref|NP_176529.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75205330|sp|Q9SH26.1|PP102_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g63400 gi|6633845|gb|AAF19704.1|AC008047_11 F2K11.22 [Arabidopsis thaliana] gi|332195974|gb|AEE34095.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 577 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/71 (56%), Positives = 53/71 (74%) Frame = +3 Query: 3 NTIIDCLCKHRLVDQALGLLHEMTKKGITPNVITYSSLIQGMCDFNRWQDVNQLLSEMVK 182 +T+ID LCK+R D AL L EM KG+ PNVITYSSLI +C++ RW D ++LLS+M++ Sbjct: 264 STVIDSLCKYRHEDDALNLFTEMENKGVRPNVITYSSLISCLCNYERWSDASRLLSDMIE 323 Query: 183 RNISPNVYTSN 215 R I+PNV T N Sbjct: 324 RKINPNVVTFN 334