BLASTX nr result
ID: Angelica23_contig00012177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00012177 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 emb|CBI36234.3| unnamed protein product [Vitis vinifera] 83 2e-14 ref|XP_004158804.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 56 4e-06 ref|XP_004136076.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 >ref|XP_002285225.2| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Vitis vinifera] Length = 872 Score = 83.2 bits (204), Expect = 2e-14 Identities = 45/85 (52%), Positives = 57/85 (67%) Frame = +2 Query: 5 AVSTKTPQIPLNSDIHFSPISNTLKPKTLNFSRIIQRHHFSLKKTQEVSVFSPNSTDNKD 184 AVS K P I L +++ S T KPK LNFSR IQ SL+K E+SV +P+S ++ Sbjct: 2 AVSAKIPAIHLQTNLPNPHHSKTHKPKPLNFSRNIQTRQISLRKHHEISVLNPSSITAQN 61 Query: 185 PNSLICELCLHGNLEEALTHLKSLQ 259 PNSLI ELCL G+LE+AL HL S+Q Sbjct: 62 PNSLILELCLKGDLEKALIHLDSMQ 86 >emb|CBI36234.3| unnamed protein product [Vitis vinifera] Length = 906 Score = 83.2 bits (204), Expect = 2e-14 Identities = 45/85 (52%), Positives = 57/85 (67%) Frame = +2 Query: 5 AVSTKTPQIPLNSDIHFSPISNTLKPKTLNFSRIIQRHHFSLKKTQEVSVFSPNSTDNKD 184 AVS K P I L +++ S T KPK LNFSR IQ SL+K E+SV +P+S ++ Sbjct: 2 AVSAKIPAIHLQTNLPNPHHSKTHKPKPLNFSRNIQTRQISLRKHHEISVLNPSSITAQN 61 Query: 185 PNSLICELCLHGNLEEALTHLKSLQ 259 PNSLI ELCL G+LE+AL HL S+Q Sbjct: 62 PNSLILELCLKGDLEKALIHLDSMQ 86 >ref|XP_004158804.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cucumis sativus] Length = 878 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 3/68 (4%) Frame = +2 Query: 62 ISNTLKPKTLNFSRIIQRHHFSLKKTQEVSVFS---PNSTDNKDPNSLICELCLHGNLEE 232 + N PKTL+FS+ +Q H +L+KTQE+SV +S ++ N + ELCL GNLE+ Sbjct: 21 VPNNHNPKTLSFSKNLQTHKHTLRKTQEISVVGAAVSHSAIDQTQNLELRELCLQGNLEQ 80 Query: 233 ALTHLKSL 256 A+ L+S+ Sbjct: 81 AMKRLESM 88 >ref|XP_004136076.1| PREDICTED: pentatricopeptide repeat-containing protein At1g15510, chloroplastic-like [Cucumis sativus] Length = 878 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 3/68 (4%) Frame = +2 Query: 62 ISNTLKPKTLNFSRIIQRHHFSLKKTQEVSVFS---PNSTDNKDPNSLICELCLHGNLEE 232 + N PKTL+FS+ +Q H +L+KTQE+SV +S ++ N + ELCL GNLE+ Sbjct: 21 VPNNHNPKTLSFSKNLQTHKHTLRKTQEISVVGAAVSHSAIDQTQNLELRELCLQGNLEQ 80 Query: 233 ALTHLKSL 256 A+ L+S+ Sbjct: 81 AMKRLESM 88