BLASTX nr result
ID: Angelica23_contig00011732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00011732 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP19448.1| hexose transporter [Camellia sinensis] 134 1e-29 gb|AAF74569.1|AF215855_1 hexose transporter [Arabidopsis thaliana] 130 8e-29 dbj|BAH19908.1| AT5G16150 [Arabidopsis thaliana] 130 8e-29 ref|NP_568328.1| Plastidic glucose transporter 4 [Arabidopsis th... 130 8e-29 ref|XP_002871705.1| GLT1 [Arabidopsis lyrata subsp. lyrata] gi|2... 130 1e-28 >gb|AFP19448.1| hexose transporter [Camellia sinensis] Length = 547 Score = 134 bits (336), Expect = 1e-29 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = +3 Query: 3 LGAILFGYHLGVVNGALECLSRDLGIAENTALQGWIVSTLLAGATVGSFTGGALADKFGR 182 LGAILFGYHLGVVNGALE LS+DLGIAENT +QGWIVSTLLAGATVGSFTGGALADKFGR Sbjct: 115 LGAILFGYHLGVVNGALEYLSKDLGIAENTVIQGWIVSTLLAGATVGSFTGGALADKFGR 174 Query: 183 TKTFQLDAIP 212 TKTFQLDAIP Sbjct: 175 TKTFQLDAIP 184 >gb|AAF74569.1|AF215855_1 hexose transporter [Arabidopsis thaliana] Length = 515 Score = 130 bits (328), Expect = 8e-29 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 LGAILFGYHLGVVNGALECLSRDLGIAENTALQGWIVSTLLAGATVGSFTGGALADKFGR 182 LGAILFGYHLGVVNGALE L++DLGIAENT LQGWIVS+LLAGATVGSFTGGALADKFGR Sbjct: 80 LGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGALADKFGR 139 Query: 183 TKTFQLDAIP 212 T+TFQLDAIP Sbjct: 140 TRTFQLDAIP 149 >dbj|BAH19908.1| AT5G16150 [Arabidopsis thaliana] Length = 546 Score = 130 bits (328), Expect = 8e-29 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 LGAILFGYHLGVVNGALECLSRDLGIAENTALQGWIVSTLLAGATVGSFTGGALADKFGR 182 LGAILFGYHLGVVNGALE L++DLGIAENT LQGWIVS+LLAGATVGSFTGGALADKFGR Sbjct: 114 LGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGALADKFGR 173 Query: 183 TKTFQLDAIP 212 T+TFQLDAIP Sbjct: 174 TRTFQLDAIP 183 >ref|NP_568328.1| Plastidic glucose transporter 4 [Arabidopsis thaliana] gi|30685706|ref|NP_850828.1| Plastidic glucose transporter 4 [Arabidopsis thaliana] gi|42573381|ref|NP_974787.1| Plastidic glucose transporter 4 [Arabidopsis thaliana] gi|117940139|sp|Q56ZZ7.2|PLST4_ARATH RecName: Full=Plastidic glucose transporter 4; Short=AtpGlcT gi|16648753|gb|AAL25568.1| AT5g16150/T21H19_70 [Arabidopsis thaliana] gi|20259506|gb|AAM13873.1| putative sugar transporter [Arabidopsis thaliana] gi|21436467|gb|AAM51434.1| putative sugar transporter [Arabidopsis thaliana] gi|332004870|gb|AED92253.1| Plastidic glucose transporter 4 [Arabidopsis thaliana] gi|332004871|gb|AED92254.1| Plastidic glucose transporter 4 [Arabidopsis thaliana] gi|332004872|gb|AED92255.1| Plastidic glucose transporter 4 [Arabidopsis thaliana] Length = 546 Score = 130 bits (328), Expect = 8e-29 Identities = 64/70 (91%), Positives = 68/70 (97%) Frame = +3 Query: 3 LGAILFGYHLGVVNGALECLSRDLGIAENTALQGWIVSTLLAGATVGSFTGGALADKFGR 182 LGAILFGYHLGVVNGALE L++DLGIAENT LQGWIVS+LLAGATVGSFTGGALADKFGR Sbjct: 114 LGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGALADKFGR 173 Query: 183 TKTFQLDAIP 212 T+TFQLDAIP Sbjct: 174 TRTFQLDAIP 183 >ref|XP_002871705.1| GLT1 [Arabidopsis lyrata subsp. lyrata] gi|297317542|gb|EFH47964.1| GLT1 [Arabidopsis lyrata subsp. lyrata] Length = 545 Score = 130 bits (327), Expect = 1e-28 Identities = 64/70 (91%), Positives = 67/70 (95%) Frame = +3 Query: 3 LGAILFGYHLGVVNGALECLSRDLGIAENTALQGWIVSTLLAGATVGSFTGGALADKFGR 182 LGAILFGYHLGVVNGALE L++DLGIAENT LQGWIVS LLAGATVGSFTGGALADKFGR Sbjct: 113 LGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSALLAGATVGSFTGGALADKFGR 172 Query: 183 TKTFQLDAIP 212 T+TFQLDAIP Sbjct: 173 TRTFQLDAIP 182