BLASTX nr result
ID: Angelica23_contig00011706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00011706 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524903.1| hypothetical protein RCOM_0725510 [Ricinus c... 58 7e-07 >ref|XP_002524903.1| hypothetical protein RCOM_0725510 [Ricinus communis] gi|223535866|gb|EEF37527.1| hypothetical protein RCOM_0725510 [Ricinus communis] Length = 509 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/111 (33%), Positives = 62/111 (55%), Gaps = 1/111 (0%) Frame = -3 Query: 330 PTH-HAIHDTKLYNACHEKITYACGQNITEGIGFPFWGDGIRSQDCGLPGFKLSCEESGL 154 PT+ +++ D + Y+ C ++CG I +PFWG+G + CGLPGF++ CEE Sbjct: 20 PTYVYSVDDYEPYSNC---TPFSCGN--MSSISYPFWGNG-QPDYCGLPGFRIDCEEGIS 73 Query: 153 AVDIGSSIKYHVVGFNSSKKVIQLNWSYNPLDFICKSSSNSIPAKVLNQSL 1 +DI S+KYHV+ + +++++ + + LD IC P + LN L Sbjct: 74 ILDI-MSLKYHVIDIDPESQILRIARA-DLLDKIC-------PVQYLNTDL 115