BLASTX nr result
ID: Angelica23_contig00010588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00010588 (1746 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271841.2| PREDICTED: gibberellin 20 oxidase 1-B-like [... 71 1e-09 ref|XP_002302586.1| 2-oxoglutarate-dependent dioxygenase [Populu... 70 2e-09 ref|XP_002510984.1| gibberellin 20-oxidase, putative [Ricinus co... 69 4e-09 ref|XP_002274751.1| PREDICTED: gibberellin 20 oxidase 1-B [Vitis... 69 4e-09 ref|NP_001240043.1| uncharacterized protein LOC100812108 [Glycin... 67 1e-08 >ref|XP_002271841.2| PREDICTED: gibberellin 20 oxidase 1-B-like [Vitis vinifera] gi|302143842|emb|CBI22703.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 70.9 bits (172), Expect = 1e-09 Identities = 35/63 (55%), Positives = 43/63 (68%), Gaps = 5/63 (7%) Frame = -2 Query: 923 WRAANLKKW-----LAEFSVNQYSVPFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADY 759 W ANL+ L + VN+ S+ FFWCFED+K I PNEVVGEG+ R ++PFV ADY Sbjct: 233 WSNANLRSSEHRVVLKQQHVNRLSLAFFWCFEDDKVIISPNEVVGEGNSRIYQPFVCADY 292 Query: 758 LKF 750 LKF Sbjct: 293 LKF 295 >ref|XP_002302586.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] gi|222844312|gb|EEE81859.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] Length = 316 Score = 69.7 bits (169), Expect = 2e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -2 Query: 881 VNQYSVPFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 750 VN+ S+ FFWCFEDEK I PNEVVGEG+ R ++PFV +DYLKF Sbjct: 249 VNRLSLAFFWCFEDEKVIMAPNEVVGEGNARIYEPFVCSDYLKF 292 >ref|XP_002510984.1| gibberellin 20-oxidase, putative [Ricinus communis] gi|223550099|gb|EEF51586.1| gibberellin 20-oxidase, putative [Ricinus communis] Length = 318 Score = 68.9 bits (167), Expect = 4e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -2 Query: 881 VNQYSVPFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKFLAAVRK 732 V+++S+ FFWCFED+K I PNEVVGEG+LR +KPFV DYL F + K Sbjct: 249 VHRFSLAFFWCFEDDKVIFAPNEVVGEGNLRMYKPFVCRDYLNFRESSEK 298 >ref|XP_002274751.1| PREDICTED: gibberellin 20 oxidase 1-B [Vitis vinifera] gi|147834194|emb|CAN75307.1| hypothetical protein VITISV_040404 [Vitis vinifera] gi|297745296|emb|CBI40376.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 68.9 bits (167), Expect = 4e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 881 VNQYSVPFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKFLAAVRK 732 VN++S+ FFWCFEDEK I P+EV+GEG+ R +KPFV DY+KF + K Sbjct: 251 VNRFSLAFFWCFEDEKVILAPDEVIGEGNTRMYKPFVCLDYVKFRESSEK 300 >ref|NP_001240043.1| uncharacterized protein LOC100812108 [Glycine max] gi|255645239|gb|ACU23117.1| unknown [Glycine max] Length = 319 Score = 67.0 bits (162), Expect = 1e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 878 NQYSVPFFWCFEDEKEICVPNEVVGEGSLRAFKPFVFADYLKF 750 N++S+ FFWCFED+K I P+EVVGEG+ R +KPFV DYLKF Sbjct: 251 NRFSLSFFWCFEDDKVILAPDEVVGEGNKRKYKPFVCLDYLKF 293