BLASTX nr result
ID: Angelica23_contig00010579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00010579 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632591.1| PREDICTED: macrophage migration inhibitory f... 98 6e-19 ref|XP_002263560.1| PREDICTED: macrophage migration inhibitory f... 98 6e-19 gb|AFW90560.1| light-inducible protein ATLS1 [Solanum tuberosum] 97 2e-18 ref|XP_002526685.1| light-inducible protein atls1, putative [Ric... 96 3e-18 ref|XP_004173159.1| PREDICTED: macrophage migration inhibitory f... 95 5e-18 >ref|XP_003632591.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 2 [Vitis vinifera] gi|297735608|emb|CBI18102.3| unnamed protein product [Vitis vinifera] Length = 121 Score = 98.2 bits (243), Expect = 6e-19 Identities = 46/53 (86%), Positives = 53/53 (100%) Frame = +2 Query: 53 MPCLNISTNVSLEGIDTSAILSQATSTVAKIIGKPEAYVMIVVKGSIPIAFGG 211 MPCLN+STNVSL+G+DTS+ILS+ATSTVAKIIGKPEAYVMIV+KGS+PIAFGG Sbjct: 1 MPCLNLSTNVSLDGVDTSSILSEATSTVAKIIGKPEAYVMIVLKGSVPIAFGG 53 >ref|XP_002263560.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 1 [Vitis vinifera] Length = 115 Score = 98.2 bits (243), Expect = 6e-19 Identities = 46/53 (86%), Positives = 53/53 (100%) Frame = +2 Query: 53 MPCLNISTNVSLEGIDTSAILSQATSTVAKIIGKPEAYVMIVVKGSIPIAFGG 211 MPCLN+STNVSL+G+DTS+ILS+ATSTVAKIIGKPEAYVMIV+KGS+PIAFGG Sbjct: 1 MPCLNLSTNVSLDGVDTSSILSEATSTVAKIIGKPEAYVMIVLKGSVPIAFGG 53 >gb|AFW90560.1| light-inducible protein ATLS1 [Solanum tuberosum] Length = 115 Score = 96.7 bits (239), Expect = 2e-18 Identities = 44/53 (83%), Positives = 53/53 (100%) Frame = +2 Query: 53 MPCLNISTNVSLEGIDTSAILSQATSTVAKIIGKPEAYVMIVVKGSIPIAFGG 211 MPCLNISTNV+LEG+DTS++LS+ATSTVAK+IGKPEAYVMIV+KGS+P+AFGG Sbjct: 1 MPCLNISTNVNLEGVDTSSVLSEATSTVAKLIGKPEAYVMIVLKGSVPMAFGG 53 >ref|XP_002526685.1| light-inducible protein atls1, putative [Ricinus communis] gi|223533985|gb|EEF35707.1| light-inducible protein atls1, putative [Ricinus communis] Length = 115 Score = 95.9 bits (237), Expect = 3e-18 Identities = 45/53 (84%), Positives = 52/53 (98%) Frame = +2 Query: 53 MPCLNISTNVSLEGIDTSAILSQATSTVAKIIGKPEAYVMIVVKGSIPIAFGG 211 MPCLN+STNV L+G+DTSAILS+ATS+VAKIIGKPEAYVMIV+KGS+PIAFGG Sbjct: 1 MPCLNLSTNVPLDGVDTSAILSEATSSVAKIIGKPEAYVMIVLKGSVPIAFGG 53 >ref|XP_004173159.1| PREDICTED: macrophage migration inhibitory factor homolog isoform 2 [Cucumis sativus] Length = 115 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/53 (83%), Positives = 53/53 (100%) Frame = +2 Query: 53 MPCLNISTNVSLEGIDTSAILSQATSTVAKIIGKPEAYVMIVVKGSIPIAFGG 211 MPCLNISTNV+LEGIDTS++LS+A+STVAKIIGKPEAYVMIV+KGS+P++FGG Sbjct: 1 MPCLNISTNVNLEGIDTSSVLSEASSTVAKIIGKPEAYVMIVLKGSVPMSFGG 53