BLASTX nr result
ID: Angelica23_contig00010499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00010499 (512 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|1... 80 2e-13 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 79 5e-13 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 75 4e-12 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 72 4e-11 >ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| predicted protein [Populus trichocarpa] Length = 54 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/54 (70%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +2 Query: 56 MFPGF--QKPEKKAALKQLRIHGAMFGAWVVAIRVTPYVLHYFSHQKQELSLDF 211 MFPG +KP+K ALKQLR H AMFGAWVV +RVTPYVLHY SH+K EL L+F Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLEF 54 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/54 (70%), Positives = 42/54 (77%), Gaps = 2/54 (3%) Frame = +2 Query: 56 MFPGF--QKPEKKAALKQLRIHGAMFGAWVVAIRVTPYVLHYFSHQKQELSLDF 211 MFPG +KP+K AALKQLR H AMFG WV IRVTPYVLHY S +K+EL LDF Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/54 (68%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +2 Query: 56 MFPGF--QKPEKKAALKQLRIHGAMFGAWVVAIRVTPYVLHYFSHQKQELSLDF 211 MFPG +KP+K AALKQL+ H A+FGAWV IRVTPYVLHY S K EL LDF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/54 (66%), Positives = 42/54 (77%), Gaps = 2/54 (3%) Frame = +2 Query: 56 MFPGF--QKPEKKAALKQLRIHGAMFGAWVVAIRVTPYVLHYFSHQKQELSLDF 211 MFPG +KP+K ALKQL+ H AMFGAWVV +RVTPYVLHY S +K EL L+F Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +2 Query: 56 MFPGF--QKPEKKAALKQLRIHGAMFGAWVVAIRVTPYVLHYFSHQKQELSLD 208 MFPG +KP+K AALKQL+ H AMFG WVV IRVTPYVLH+ +K+EL L+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLE 53