BLASTX nr result
ID: Angelica23_contig00010316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00010316 (1105 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270491.1| PREDICTED: sister chromatid cohesion 1 prote... 87 2e-17 ref|XP_002331697.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-17 emb|CBI40063.3| unnamed protein product [Vitis vinifera] 87 3e-17 ref|XP_004159806.1| PREDICTED: uncharacterized protein LOC101227... 80 2e-15 ref|XP_002509552.1| Sister chromatid cohesion 1 protein, putativ... 89 3e-15 >ref|XP_002270491.1| PREDICTED: sister chromatid cohesion 1 protein 2-like [Vitis vinifera] Length = 756 Score = 87.0 bits (214), Expect(2) = 2e-17 Identities = 44/72 (61%), Positives = 53/72 (73%) Frame = +1 Query: 211 VTNKILLDEVPVVTYRILAYLLLGVVRIYSKKVEYLFRDCNDMLSEVRQFVTSKKCDADI 390 V KIL+DEVPV+ YRIL Y+LLGVVRIYSKKVEYLF DC ML +V+ F K+ +AD+ Sbjct: 207 VNYKILVDEVPVLAYRILGYILLGVVRIYSKKVEYLFDDCQKMLIKVKDFAVGKQFNADM 266 Query: 391 VFMCAPYSSITM 426 AP SIT+ Sbjct: 267 EGFSAPCFSITL 278 Score = 28.9 bits (63), Expect(2) = 2e-17 Identities = 11/21 (52%), Positives = 19/21 (90%) Frame = +2 Query: 416 LSLCERFELDAFDLEIIENLN 478 ++L + FELDAFDLE++E+++ Sbjct: 276 ITLPKTFELDAFDLEVLEDVS 296 >ref|XP_002331697.1| predicted protein [Populus trichocarpa] gi|222874175|gb|EEF11306.1| predicted protein [Populus trichocarpa] Length = 770 Score = 82.4 bits (202), Expect(2) = 3e-17 Identities = 44/72 (61%), Positives = 51/72 (70%) Frame = +1 Query: 217 NKILLDEVPVVTYRILAYLLLGVVRIYSKKVEYLFRDCNDMLSEVRQFVTSKKCDADIVF 396 +KIL D VVTYR+LAYLLLGVVRIYSKKVEYLF DCN +L V+ FV K + Sbjct: 42 DKILQDGFDVVTYRVLAYLLLGVVRIYSKKVEYLFDDCNKVLLNVKDFVLCNKDGILVET 101 Query: 397 MCAPYSSITMRE 432 + APY SIT+ E Sbjct: 102 LQAPYFSITLPE 113 Score = 33.1 bits (74), Expect(2) = 3e-17 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +2 Query: 416 LSLCERFELDAFDLEIIEN 472 ++L ERFELDAFDLEIIE+ Sbjct: 109 ITLPERFELDAFDLEIIED 127 Score = 59.7 bits (143), Expect = 1e-06 Identities = 33/57 (57%), Positives = 41/57 (71%) Frame = +3 Query: 3 APYSSITMPERFELDAFDLEIIENFNRDHIKMQEEITLEGKKDGICSPSFHQSYMEE 173 APY SIT+PERFELDAFDLEIIE+ ++ EEITL+G +CS S Q+ ME+ Sbjct: 104 APYFSITLPERFELDAFDLEIIEDTIGGNVMPHEEITLKGT---LCSVSTLQASMEK 157 >emb|CBI40063.3| unnamed protein product [Vitis vinifera] Length = 621 Score = 86.7 bits (213), Expect(2) = 3e-17 Identities = 43/70 (61%), Positives = 53/70 (75%) Frame = +1 Query: 217 NKILLDEVPVVTYRILAYLLLGVVRIYSKKVEYLFRDCNDMLSEVRQFVTSKKCDADIVF 396 +KIL+DEVPV+ YRIL Y+LLGVVRIYSKKVEYLF DC ML +V+ F K+ +AD+ Sbjct: 42 DKILVDEVPVLAYRILGYILLGVVRIYSKKVEYLFDDCQKMLIKVKDFAVGKQFNADMEG 101 Query: 397 MCAPYSSITM 426 AP SIT+ Sbjct: 102 FSAPCFSITL 111 Score = 28.9 bits (63), Expect(2) = 3e-17 Identities = 11/21 (52%), Positives = 19/21 (90%) Frame = +2 Query: 416 LSLCERFELDAFDLEIIENLN 478 ++L + FELDAFDLE++E+++ Sbjct: 109 ITLPKTFELDAFDLEVLEDVS 129 >ref|XP_004159806.1| PREDICTED: uncharacterized protein LOC101227114 [Cucumis sativus] Length = 320 Score = 79.7 bits (195), Expect(2) = 2e-15 Identities = 40/88 (45%), Positives = 59/88 (67%) Frame = +1 Query: 169 RNSILEVSLLFTLHVTNKILLDEVPVVTYRILAYLLLGVVRIYSKKVEYLFRDCNDMLSE 348 ++ ++E + F++ +KIL DE+ VTYR++AYLLLG+ RIYSKKVEYL+ DCN +L+E Sbjct: 29 KSLVMETDIPFSV---DKILQDELNAVTYRVMAYLLLGIARIYSKKVEYLYTDCNKVLTE 85 Query: 349 VRQFVTSKKCDADIVFMCAPYSSITMRE 432 + +FV K PY +IT+ E Sbjct: 86 INEFVVRTKNSTRKGTKQTPYYAITLPE 113 Score = 30.0 bits (66), Expect(2) = 2e-15 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 416 LSLCERFELDAFDLEIIENL 475 ++L ERFELD FDL IIE+L Sbjct: 109 ITLPERFELDEFDLGIIEDL 128 >ref|XP_002509552.1| Sister chromatid cohesion 1 protein, putative [Ricinus communis] gi|223549451|gb|EEF50939.1| Sister chromatid cohesion 1 protein, putative [Ricinus communis] Length = 781 Score = 88.6 bits (218), Expect = 3e-15 Identities = 44/72 (61%), Positives = 55/72 (76%) Frame = +1 Query: 217 NKILLDEVPVVTYRILAYLLLGVVRIYSKKVEYLFRDCNDMLSEVRQFVTSKKCDADIVF 396 +KIL DE VTYR+LAYLLLGVVRI+SKKVEYLF DCN +L +++ F+ K A + Sbjct: 42 DKILQDEFDAVTYRVLAYLLLGVVRIFSKKVEYLFDDCNKVLLKIKDFMVRNKERALMET 101 Query: 397 MCAPYSSITMRE 432 +CAPYSSIT+ E Sbjct: 102 LCAPYSSITLPE 113