BLASTX nr result
ID: Angelica23_contig00009922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00009922 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635160.1| PREDICTED: cysteine-rich receptor-like prote... 55 8e-06 >ref|XP_003635160.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like [Vitis vinifera] gi|302144222|emb|CBI23446.3| unnamed protein product [Vitis vinifera] Length = 661 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/54 (50%), Positives = 41/54 (75%) Frame = -2 Query: 307 PSEPAFFLHSTIDTEVPLLTEDFDSRLSNNSKNSTENSAKYSINEASISDLYPR 146 PS+PAFF+HS+ID E P L +DFDS ++ +S N+ S + S+N+ SI++L+PR Sbjct: 612 PSQPAFFMHSSIDPEPPFL-QDFDSGVTKSSDNA---SPQMSVNDVSITELHPR 661