BLASTX nr result
ID: Angelica23_contig00009707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00009707 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] 100 2e-19 ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing pr... 98 6e-19 ref|XP_002512181.1| protein binding protein, putative [Ricinus c... 94 9e-18 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 90 2e-16 >dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] Length = 236 Score = 99.8 bits (247), Expect = 2e-19 Identities = 44/85 (51%), Positives = 58/85 (68%), Gaps = 2/85 (2%) Frame = -1 Query: 266 KHFSHGHAMYLSEVREKQMKVCSGCDENVTGLAYVCKDNQCDFNLHKSCFDLPEQIRHSS 87 KHFSH HA+ LSEV+E +CSGC+ ++G++Y C C F LHKSCF+LP +I+H+S Sbjct: 2 KHFSHPHALELSEVQETNEIICSGCENKLSGISYKCTKPNCKFTLHKSCFELPRKIQHNS 61 Query: 86 HPNHQLTL--TISPDQSNGFTCNGC 18 HPNH LTL ++ S F CN C Sbjct: 62 HPNHPLTLYPSLPERDSIYFGCNAC 86 >ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|222872679|gb|EEF09810.1| predicted protein [Populus trichocarpa] Length = 190 Score = 98.2 bits (243), Expect = 6e-19 Identities = 42/88 (47%), Positives = 58/88 (65%), Gaps = 1/88 (1%) Frame = -1 Query: 266 KHFSHGHAMYLSEVREKQMKVCSGCDENVTGLAYVCKDNQCDFNLHKSCFDLPEQIRHSS 87 KHFSH H + +V+E++ +CSGC+ +++G AY C + CDF LHKSCF+LP ++ H+S Sbjct: 18 KHFSHSHPLRPVDVKEEEESICSGCELDLSGSAYKCTKSTCDFFLHKSCFELPRELEHTS 77 Query: 86 HPNHQLTLTIS-PDQSNGFTCNGCHKNG 6 HP H L L S P + FTCN C G Sbjct: 78 HPQHLLVLLSSPPGDDSKFTCNACGDYG 105 >ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128201|gb|AAC16105.1| unknown protein [Arabidopsis thaliana] gi|37202108|gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana] gi|51971661|dbj|BAD44495.1| unknown protein [Arabidopsis thaliana] gi|330255320|gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 247 Score = 98.2 bits (243), Expect = 6e-19 Identities = 40/87 (45%), Positives = 55/87 (63%) Frame = -1 Query: 266 KHFSHGHAMYLSEVREKQMKVCSGCDENVTGLAYVCKDNQCDFNLHKSCFDLPEQIRHSS 87 +H SH H + + + R++ VCSGC+ +TG A+ C + CD+ LHKSCFDLP + H S Sbjct: 13 RHASHNHPLRVFKARDEDEVVCSGCELELTGQAFKCMKSDCDYFLHKSCFDLPRETNHKS 72 Query: 86 HPNHQLTLTISPDQSNGFTCNGCHKNG 6 HPNH LTL SP +TC+ C + G Sbjct: 73 HPNHSLTLLHSPPYGQSYTCDACGEYG 99 >ref|XP_002512181.1| protein binding protein, putative [Ricinus communis] gi|223548725|gb|EEF50215.1| protein binding protein, putative [Ricinus communis] Length = 187 Score = 94.4 bits (233), Expect = 9e-18 Identities = 41/88 (46%), Positives = 59/88 (67%), Gaps = 1/88 (1%) Frame = -1 Query: 266 KHFSHGHAMYLSEVREKQMKVCSGCDENVTGLAYVCKDNQCDFNLHKSCFDLPEQIRHSS 87 KHFSH H + ++V+E + +C GC+ +++G AY C ++C F LHKSCF+LP++++H S Sbjct: 17 KHFSHSHPLRPADVKEDEEIICFGCELDLSGSAYKCSKSKCVFLLHKSCFELPKELQHDS 76 Query: 86 HPNHQLTLTISPDQSNG-FTCNGCHKNG 6 H H LTL SP Q + FTCN C G Sbjct: 77 HSEHLLTLLPSPPQDDSKFTCNACGDYG 104 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 90.1 bits (222), Expect = 2e-16 Identities = 39/97 (40%), Positives = 58/97 (59%), Gaps = 1/97 (1%) Frame = -1 Query: 293 PQSGASGETKHFSHGHAMYLSEVREKQMKVCSGCDENVTGLAYVCKDNQCDFNLHKSCFD 114 P + +H SH H + + + + +CSGCD ++ G + C ++CD+ LHKSCFD Sbjct: 208 PLMASRPSVRHPSHNHPLRGHKAQVEDEIICSGCDLDLLGAYFKCTKSECDYFLHKSCFD 267 Query: 113 LPEQIRHSSHPNHQLTLTISPDQSNG-FTCNGCHKNG 6 LP +IRH SHP+H L L SP +N +TC+ C + G Sbjct: 268 LPREIRHKSHPDHPLILLYSPQNNNSTYTCDACGEYG 304