BLASTX nr result
ID: Angelica23_contig00009613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00009613 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004133741.1| PREDICTED: PHD finger protein Alfin1-like [C... 74 9e-12 gb|AFY26897.1| PHD5 [Morella rubra] 74 9e-12 gb|AEF79998.1| PHD finger family protein [Corylus heterophylla] 74 9e-12 gb|ABA18096.1| PHD finger/nucleic acid binding protein [Olimarab... 74 1e-11 gb|AAC26230.1| similar to Medicago sativa nucleic acid binding p... 74 1e-11 >ref|XP_004133741.1| PREDICTED: PHD finger protein Alfin1-like [Cucumis sativus] gi|449522474|ref|XP_004168251.1| PREDICTED: PHD finger protein Alfin1-like [Cucumis sativus] Length = 255 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 WFHGKCVKITPARAEHIKQYKCPSCSNKRARV 98 WFHGKCVKITPA+AEHIKQYKCPSCSNKRARV Sbjct: 224 WFHGKCVKITPAKAEHIKQYKCPSCSNKRARV 255 >gb|AFY26897.1| PHD5 [Morella rubra] Length = 252 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 WFHGKCVKITPARAEHIKQYKCPSCSNKRARV 98 WFHGKCVKITPA+AEHIKQYKCPSCSNKRARV Sbjct: 221 WFHGKCVKITPAKAEHIKQYKCPSCSNKRARV 252 >gb|AEF79998.1| PHD finger family protein [Corylus heterophylla] Length = 253 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 WFHGKCVKITPARAEHIKQYKCPSCSNKRARV 98 WFHGKCVKITPA+AEHIKQYKCPSCSNKRARV Sbjct: 222 WFHGKCVKITPAKAEHIKQYKCPSCSNKRARV 253 >gb|ABA18096.1| PHD finger/nucleic acid binding protein [Olimarabidopsis pumila] Length = 252 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 WFHGKCVKITPARAEHIKQYKCPSCSNKRAR 95 WFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 221 WFHGKCVKITPARAEHIKQYKCPSCSNKRAR 251 >gb|AAC26230.1| similar to Medicago sativa nucleic acid binding protein Alfin-1 (GB:L07291) [Arabidopsis thaliana] Length = 251 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 WFHGKCVKITPARAEHIKQYKCPSCSNKRAR 95 WFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 220 WFHGKCVKITPARAEHIKQYKCPSCSNKRAR 250