BLASTX nr result
ID: Angelica23_contig00008153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00008153 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285898.1| PREDICTED: prolyl 4-hydroxylase subunit alph... 69 4e-10 gb|AFK48224.1| unknown [Lotus japonicus] 67 2e-09 ref|XP_003527502.1| PREDICTED: prolyl 4-hydroxylase subunit alph... 67 2e-09 ref|NP_564109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxyge... 66 3e-09 ref|XP_002893096.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 66 3e-09 >ref|XP_002285898.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2 [Vitis vinifera] gi|302141716|emb|CBI18919.3| unnamed protein product [Vitis vinifera] Length = 288 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 508 DPSSLHGGCPVIKGNKWSSTKWMHVDEYK 422 DPSSLHGGCPVIKGNKWSSTKWMHV+EYK Sbjct: 259 DPSSLHGGCPVIKGNKWSSTKWMHVEEYK 287 >gb|AFK48224.1| unknown [Lotus japonicus] Length = 188 Score = 67.0 bits (162), Expect = 2e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 508 DPSSLHGGCPVIKGNKWSSTKWMHVDEYKL 419 DPSSLHGGCPVI+GNKWSSTKWMH++EYK+ Sbjct: 159 DPSSLHGGCPVIRGNKWSSTKWMHLEEYKV 188 >ref|XP_003527502.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Glycine max] Length = 290 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 508 DPSSLHGGCPVIKGNKWSSTKWMHVDEYKL 419 DPSSLHGGCPVIKGNKWSSTKWMH+ EYK+ Sbjct: 261 DPSSLHGGCPVIKGNKWSSTKWMHLREYKV 290 >ref|NP_564109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein [Arabidopsis thaliana] gi|9558598|gb|AAF88161.1|AC026234_12 Contains similarity to a prolyl 4-hydroxylase alpha subunit protein from Gallus gallus gi|212530 [Arabidopsis thaliana] gi|90962978|gb|ABE02413.1| At1g20270 [Arabidopsis thaliana] gi|332191835|gb|AEE29956.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein [Arabidopsis thaliana] Length = 287 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 508 DPSSLHGGCPVIKGNKWSSTKWMHVDEYKL 419 DP+SLHGGCPVI+GNKWSSTKWMHV EYK+ Sbjct: 258 DPTSLHGGCPVIRGNKWSSTKWMHVGEYKI 287 >ref|XP_002893096.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297338938|gb|EFH69355.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 287 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 508 DPSSLHGGCPVIKGNKWSSTKWMHVDEYKL 419 DP+SLHGGCPVI+GNKWSSTKWMHV EYK+ Sbjct: 258 DPTSLHGGCPVIRGNKWSSTKWMHVGEYKI 287