BLASTX nr result
ID: Angelica23_contig00007976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00007976 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula] gi|35... 58 9e-07 emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisu... 58 9e-07 gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasilie... 57 1e-06 gb|AEC45512.1| plasma membrane intrinsic protein [Hevea brasilie... 57 1e-06 gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia] 55 5e-06 >ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula] gi|355486283|gb|AES67486.1| Aquaporin PIP2-7 [Medicago truncatula] Length = 287 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +3 Query: 156 MGKE-EVSEQPHEYSGKDYQDPPPAAFIGLDELGKWSFYRA 275 MGK+ EV EQ E+S KDYQDPPPA LDEL KWS YRA Sbjct: 1 MGKDVEVQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRA 41 >emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum] Length = 285 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +3 Query: 156 MGKEEVSEQPHEYSGKDYQDPPPAAFIGLDELGKWSFYRA 275 M K+ ++ EYS KDYQDPPPA I LDEL KWSFYRA Sbjct: 1 MAKDVEVQEQGEYSAKDYQDPPPAPLIDLDELTKWSFYRA 40 >gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis] Length = 278 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +3 Query: 168 EVSEQPHEYSGKDYQDPPPAAFIGLDELGKWSFYRA 275 EV+E P E+S KDY DPPPA I ++ELGKWS YRA Sbjct: 6 EVAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRA 41 >gb|AEC45512.1| plasma membrane intrinsic protein [Hevea brasiliensis] Length = 273 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +3 Query: 168 EVSEQPHEYSGKDYQDPPPAAFIGLDELGKWSFYRA 275 EV+E P E+S KDY DPPPA I ++ELGKWS YRA Sbjct: 6 EVAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRA 41 >gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia] Length = 284 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = +3 Query: 156 MGKEEVSEQPHEYSGKDYQDPPPAAFIGLDELGKWSFYRA 275 MGK+ + EYS KDYQDPPPA I +EL KWSFYRA Sbjct: 1 MGKDVEGAEQGEYSAKDYQDPPPAPLIDPEELTKWSFYRA 40