BLASTX nr result
ID: Angelica23_contig00007872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00007872 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173694.1| PREDICTED: LRR receptor-like serine/threonin... 78 9e-13 ref|XP_004143187.1| PREDICTED: LRR receptor-like serine/threonin... 78 9e-13 ref|XP_002328588.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002881874.1| leucine-rich repeat family protein [Arabidop... 67 2e-09 ref|NP_181808.1| receptor like protein 29 [Arabidopsis thaliana]... 67 2e-09 >ref|XP_004173694.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like, partial [Cucumis sativus] Length = 446 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 167 NLQPNSMEPVELETLFKIMDSMSSDETWRITYPNPCKPGSSWMGI 301 NL P SM P ELETLFKIMDSMS+D+ WR++YPNPC+PGSSW G+ Sbjct: 19 NLAPISMLPFELETLFKIMDSMSTDQNWRLSYPNPCQPGSSWPGL 63 >ref|XP_004143187.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like [Cucumis sativus] Length = 449 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 167 NLQPNSMEPVELETLFKIMDSMSSDETWRITYPNPCKPGSSWMGI 301 NL P SM P ELETLFKIMDSMS+D+ WR++YPNPC+PGSSW G+ Sbjct: 19 NLAPISMLPFELETLFKIMDSMSTDQNWRLSYPNPCQPGSSWPGL 63 >ref|XP_002328588.1| predicted protein [Populus trichocarpa] gi|222838570|gb|EEE76935.1| predicted protein [Populus trichocarpa] Length = 398 Score = 69.7 bits (169), Expect = 2e-10 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +2 Query: 182 SMEPVELETLFKIMDSMSSDETWRITYPNPCKPGSSWMGI 301 +M P E+ET+FKIM+S+SSDE WRI+YPNPC PGS+W+GI Sbjct: 11 NMLPSEVETIFKIMESISSDEKWRISYPNPCNPGSTWLGI 50 >ref|XP_002881874.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297327713|gb|EFH58133.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 468 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +2 Query: 161 KKNLQPNSMEPVELETLFKIMDSMSSDETWRITYPNPCKPGSSWMGI 301 ++N SM P E ETLFKIM+SMSSD+ WR ++PNPC PGSSW GI Sbjct: 26 QENRVSASMPPSESETLFKIMESMSSDQQWRQSHPNPCAPGSSWPGI 72 >ref|NP_181808.1| receptor like protein 29 [Arabidopsis thaliana] gi|4512674|gb|AAD21728.1| hypothetical protein [Arabidopsis thaliana] gi|66792706|gb|AAY56455.1| At2g42800 [Arabidopsis thaliana] gi|330255076|gb|AEC10170.1| receptor like protein 29 [Arabidopsis thaliana] Length = 462 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +2 Query: 161 KKNLQPNSMEPVELETLFKIMDSMSSDETWRITYPNPCKPGSSWMGI 301 ++N SM P E ETLFKIM+SMSSD+ WR ++PNPC PGSSW GI Sbjct: 27 QENRVSASMPPSESETLFKIMESMSSDQQWRQSHPNPCAPGSSWPGI 73