BLASTX nr result
ID: Angelica23_contig00007661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00007661 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] 95 4e-18 >dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] Length = 988 Score = 95.1 bits (235), Expect(2) = 4e-18 Identities = 50/93 (53%), Positives = 57/93 (61%) Frame = +1 Query: 70 VRRQSDAIIYKGWLDNARKKYSELVSTARFDWENYNKRDNRVGMNVYLSWVEFWKMMEFK 249 V RQ D IYK W+ AR +YS S AR WE + DNRV M+V+L WVEFWK +F+ Sbjct: 735 VWRQEDKQIYKVWVKKARNRYSNFCSDARKKWEA-GEVDNRVAMHVWLPWVEFWKTPDFQ 793 Query: 250 KKSTIQKNNRRSGDDGLPSTHTSGSASHRVVTA 348 KS QK NRR G D P THT GSAS R A Sbjct: 794 TKSKTQKKNRRGGTDHYPPTHTGGSASLRTHAA 826 Score = 21.9 bits (45), Expect(2) = 4e-18 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 446 EPTADQLFKLTHTRRVKKK 502 +PT ++ LTHT++ KK Sbjct: 835 DPTPADVYLLTHTKKRDKK 853