BLASTX nr result
ID: Angelica23_contig00006445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00006445 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545936.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 emb|CBI20322.3| unnamed protein product [Vitis vinifera] 76 2e-12 ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containi... 76 2e-12 ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-11 ref|XP_004137020.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-11 >ref|XP_003545936.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Glycine max] Length = 486 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/72 (50%), Positives = 50/72 (69%) Frame = -2 Query: 223 RSYSSATISKPSNNSRLFQRISTLRDPTVSIIPVLDQWITEGNKLKEPEFQRFVRELRAR 44 RSY ++ KPS L+ +IS L +P S++PVLD W+ +GNKL+ E QR +R+LR R Sbjct: 11 RSYYTSRSKKPS----LYSKISPLGNPNTSVVPVLDDWVFKGNKLRVAELQRIIRDLRKR 66 Query: 43 KRYSQALQLCEW 8 R+SQALQ+ EW Sbjct: 67 SRFSQALQISEW 78 >emb|CBI20322.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 76.3 bits (186), Expect = 2e-12 Identities = 32/61 (52%), Positives = 46/61 (75%) Frame = -2 Query: 184 NSRLFQRISTLRDPTVSIIPVLDQWITEGNKLKEPEFQRFVRELRARKRYSQALQLCEWA 5 N L+ RIS L P +S++PVLDQW+ EG K+++ E R +R+LR+RKRY+QAL++ EW Sbjct: 36 NINLYSRISPLGTPNLSLVPVLDQWVEEGKKVRDVELHRIIRDLRSRKRYAQALEVSEWM 95 Query: 4 S 2 S Sbjct: 96 S 96 >ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial [Vitis vinifera] Length = 504 Score = 76.3 bits (186), Expect = 2e-12 Identities = 32/61 (52%), Positives = 46/61 (75%) Frame = -2 Query: 184 NSRLFQRISTLRDPTVSIIPVLDQWITEGNKLKEPEFQRFVRELRARKRYSQALQLCEWA 5 N L+ RIS L P +S++PVLDQW+ EG K+++ E R +R+LR+RKRY+QAL++ EW Sbjct: 36 NINLYSRISPLGTPNLSLVPVLDQWVEEGKKVRDVELHRIIRDLRSRKRYAQALEVSEWM 95 Query: 4 S 2 S Sbjct: 96 S 96 >ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 493 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/70 (44%), Positives = 47/70 (67%) Frame = -2 Query: 217 YSSATISKPSNNSRLFQRISTLRDPTVSIIPVLDQWITEGNKLKEPEFQRFVRELRARKR 38 YS+ ++ PS LF+R+ DP SI+ VLDQW+ EG ++K+ + Q +++LR R Sbjct: 24 YSTKSLPSPSTEDTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRKFGR 83 Query: 37 YSQALQLCEW 8 ++QALQLCEW Sbjct: 84 FNQALQLCEW 93 >ref|XP_004137020.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 146 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/70 (44%), Positives = 47/70 (67%) Frame = -2 Query: 217 YSSATISKPSNNSRLFQRISTLRDPTVSIIPVLDQWITEGNKLKEPEFQRFVRELRARKR 38 YS+ ++ PS LF+R+ DP SI+ VLDQW+ EG ++K+ + Q +++LR R Sbjct: 24 YSTKSLPSPSTEDTLFRRVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRKFGR 83 Query: 37 YSQALQLCEW 8 ++QALQLCEW Sbjct: 84 FNQALQLCEW 93