BLASTX nr result
ID: Angelica23_contig00006087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00006087 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_567449.1| 5'-nucleotidase [Arabidopsis thaliana] gi|21593... 57 2e-06 ref|XP_002870272.1| hypothetical protein ARALYDRAFT_493398 [Arab... 57 2e-06 dbj|BAD94767.1| hypothetical protein [Arabidopsis thaliana] 57 2e-06 >ref|NP_567449.1| 5'-nucleotidase [Arabidopsis thaliana] gi|21593317|gb|AAM65266.1| unknown [Arabidopsis thaliana] gi|27311791|gb|AAO00861.1| expressed protein [Arabidopsis thaliana] gi|30984528|gb|AAP42727.1| At4g14930 [Arabidopsis thaliana] gi|332658124|gb|AEE83524.1| 5'-nucleotidase [Arabidopsis thaliana] Length = 315 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 287 LKEGYITVTPLGALTNAERECQSYFKEWLPVVDPTPQHCNADS 159 LKEG+ITVTPLGAL+ + +CQ+Y+KEWLP + T Q C++ S Sbjct: 274 LKEGFITVTPLGALSQTDVDCQNYYKEWLPKI--TNQSCSSSS 314 >ref|XP_002870272.1| hypothetical protein ARALYDRAFT_493398 [Arabidopsis lyrata subsp. lyrata] gi|297316108|gb|EFH46531.1| hypothetical protein ARALYDRAFT_493398 [Arabidopsis lyrata subsp. lyrata] Length = 316 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 287 LKEGYITVTPLGALTNAERECQSYFKEWLPVVDPTPQHCNADS 159 LKEG+ITVTPLGAL+ + +CQ+Y+KEWLP + T Q C++ S Sbjct: 275 LKEGFITVTPLGALSQTDVDCQNYYKEWLPKI--TNQSCSSSS 315 >dbj|BAD94767.1| hypothetical protein [Arabidopsis thaliana] Length = 134 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 287 LKEGYITVTPLGALTNAERECQSYFKEWLPVVDPTPQHCNADS 159 LKEG+ITVTPLGAL+ + +CQ+Y+KEWLP + T Q C++ S Sbjct: 93 LKEGFITVTPLGALSQTDVDCQNYYKEWLPKI--TNQSCSSSS 133